Telomere_Sde2_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Telomere_Sde2_2 - Telomere stability C-terminal

PFAM:	PF13297	Sequences: LDLDAFSSAEELEALGLDRLKSALMALGLKCGGTLQERAERLFSVKGLPLEELPKKLFAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	60 (60)
Sequences:	650 (461)
Seq/√Len:	59.5
META:	0.602

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_A	26_A	3.802	1.00
37_E	40_E	2.938	1.00
13_E	36_Q	2.784	1.00
17_L	35_L	2.485	1.00
2_D	5_A	2.360	1.00
7_S	11_E	1.998	1.00
29_L	45_V	1.898	1.00
49_P	52_E	1.773	0.99
48_L	52_E	1.654	0.99
16_G	35_L	1.644	0.99
50_L	53_L	1.638	0.99
27_L	45_V	1.579	0.99
43_F	46_K	1.468	0.98
48_L	53_L	1.431	0.97
19_R	26_A	1.429	0.97
45_V	53_L	1.373	0.97
53_L	57_L	1.356	0.96
44_S	57_L	1.341	0.96
25_M	31_C	1.320	0.96
21_K	31_C	1.314	0.96
9_A	13_E	1.282	0.95
10_E	36_Q	1.221	0.93
53_L	58_F	1.170	0.92
3_L	12_L	1.163	0.92
44_S	47_G	1.161	0.92
10_E	13_E	1.156	0.91
55_K	58_F	1.150	0.91
1_L	19_R	1.148	0.91
45_V	50_L	1.081	0.88
8_S	11_E	1.075	0.88
20_L	35_L	1.006	0.85
28_G	58_F	0.982	0.83
44_S	53_L	0.946	0.81
18_D	21_K	0.935	0.80
6_F	15_L	0.925	0.79
50_L	58_F	0.905	0.78
18_D	31_C	0.900	0.77
36_Q	40_E	0.894	0.77
16_G	19_R	0.857	0.74
19_R	23_A	0.855	0.74
18_D	22_S	0.840	0.72
6_F	9_A	0.812	0.70
19_R	22_S	0.809	0.69
45_V	48_L	0.808	0.69
4_D	7_S	0.789	0.67
12_L	39_A	0.775	0.66
17_L	55_K	0.751	0.64
4_D	47_G	0.737	0.62
17_L	20_L	0.721	0.60
49_P	53_L	0.706	0.59
54_P	57_L	0.701	0.58
26_A	34_T	0.695	0.58
4_D	46_K	0.691	0.57
19_R	31_C	0.683	0.56
40_E	59_A	0.677	0.56
1_L	15_L	0.669	0.55
45_V	57_L	0.660	0.54
33_G	41_R	0.655	0.53
23_A	27_L	0.652	0.53
11_E	14_A	0.644	0.52
44_S	50_L	0.643	0.52
5_A	11_E	0.642	0.52
34_T	38_R	0.641	0.52
9_A	36_Q	0.630	0.50
12_L	29_L	0.625	0.50
4_D	22_S	0.624	0.50
25_M	60_K	0.615	0.49
29_L	59_A	0.611	0.48
32_G	38_R	0.602	0.47
48_L	57_L	0.601	0.47
3_L	23_A	0.600	0.47
22_S	25_M	0.595	0.47
44_S	48_L	0.587	0.46
2_D	28_G	0.586	0.46
17_L	38_R	0.586	0.46
52_E	57_L	0.564	0.43
31_C	37_E	0.557	0.42
30_K	38_R	0.556	0.42
7_S	10_E	0.541	0.41
29_L	58_F	0.540	0.41
15_L	35_L	0.535	0.40
40_E	52_E	0.527	0.39
14_A	22_S	0.524	0.39
37_E	54_P	0.523	0.39
8_S	43_F	0.521	0.38
29_L	46_K	0.520	0.38
18_D	38_R	0.516	0.38
11_E	20_L	0.508	0.37
15_L	19_R	0.507	0.37
42_L	46_K	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kvuA	1	0.9833	84.4	0.787	Contact Map
1h1jS	1	0.6833	83.1	0.791	Contact Map
1jjrA	1	0.2	78.1	0.801	Contact Map
1jeyA	1	0	68.3	0.815	Contact Map
2rnnA	1	1	67.3	0.817	Contact Map
1zrjA	1	0.8333	66.2	0.818	Contact Map
2do1A	1	0.9167	63.2	0.821	Contact Map
4dgwA	1	0.8333	32.4	0.852	Contact Map
4rxiA	1	0.5667	22.8	0.863	Contact Map
4z3xA	2	0.55	16.3	0.871	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.