WYL - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WYL - WYL domain

PFAM:	PF13280	Sequences: EVLETLAEAIRERRRVRFDYRSARGEGTERTVEPYGLVFKGGRWYLVAYDHDRGDIRTFRLDRIRSVEVLDERFERPDFDLAAYLARSFGVFEGPVEVRLRFSPEAARYVRERPWPSQQIEEELDDGSVRVTLPVADLEELARWLLSFGPDVEVLEPPELREEVRERARRAL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	172 (170)
Sequences:	68814 (53095)
Seq/√Len:	4072.2
META:	0.829

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_R	33_E	2.993	1.00
33_E	51_H	2.791	1.00
99_R	130_R	2.687	1.00
142_A	163_E	2.618	1.00
101_R	128_S	2.344	1.00
97_E	134_P	2.332	1.00
19_D	29_E	2.331	1.00
17_R	31_T	2.296	1.00
17_R	29_E	2.214	1.00
99_R	132_T	2.207	1.00
97_E	132_T	2.169	1.00
101_R	130_R	2.155	1.00
99_R	156_E	2.145	1.00
124_L	130_R	2.122	1.00
168_A	171_A	2.120	1.00
14_R	69_V	2.048	1.00
101_R	153_E	2.034	1.00
19_D	66_S	2.016	1.00
18_F	32_V	1.988	1.00
15_R	31_T	1.987	1.00
103_S	151_D	1.963	1.00
32_V	48_A	1.962	1.00
18_F	64_I	1.952	1.00
8_E	12_E	1.931	1.00
101_R	155_L	1.840	1.00
15_R	51_H	1.832	1.00
150_P	167_R	1.812	1.00
142_A	167_R	1.809	1.00
146_L	167_R	1.808	1.00
96_V	159_E	1.693	1.00
15_R	72_E	1.669	1.00
6_L	16_V	1.647	1.00
105_E	151_D	1.603	1.00
17_R	70_L	1.600	1.00
32_V	46_L	1.599	1.00
165_R	169_R	1.592	1.00
150_P	170_R	1.579	1.00
21_R	65_R	1.573	1.00
158_P	162_E	1.568	1.00
17_R	68_E	1.536	1.00
138_L	163_E	1.532	1.00
5_T	67_V	1.396	1.00
138_L	159_E	1.386	1.00
163_E	167_R	1.368	1.00
53_R	57_R	1.366	1.00
144_W	147_S	1.355	1.00
130_R	155_L	1.332	1.00
153_E	161_R	1.318	1.00
124_L	128_S	1.317	1.00
31_T	72_E	1.306	1.00
99_R	155_L	1.297	1.00
50_D	53_R	1.282	1.00
48_A	59_F	1.275	1.00
106_A	151_D	1.268	1.00
163_E	166_E	1.266	1.00
161_R	165_R	1.249	1.00
30_R	50_D	1.247	1.00
35_Y	56_I	1.245	1.00
19_D	65_R	1.235	1.00
14_R	71_D	1.225	1.00
33_E	49_Y	1.211	1.00
21_R	27_G	1.202	1.00
9_A	69_V	1.192	1.00
142_A	164_V	1.191	1.00
49_Y	54_G	1.187	1.00
14_R	73_R	1.174	1.00
166_E	170_R	1.170	1.00
95_P	134_P	1.170	1.00
2_V	5_T	1.168	1.00
101_R	124_L	1.159	1.00
31_T	51_H	1.153	1.00
103_S	128_S	1.149	1.00
8_E	69_V	1.140	1.00
43_R	60_R	1.137	1.00
50_D	57_R	1.127	1.00
167_R	170_R	1.126	1.00
33_E	74_F	1.116	1.00
30_R	59_F	1.086	1.00
31_T	70_L	1.082	1.00
100_L	145_L	1.074	1.00
18_F	59_F	1.066	1.00
5_T	69_V	1.058	1.00
158_P	161_R	1.053	1.00
154_V	164_V	1.049	1.00
102_F	110_V	1.040	1.00
125_D	128_S	1.034	1.00
5_T	8_E	1.022	1.00
162_E	166_E	1.013	1.00
142_A	160_L	1.008	1.00
139_E	163_E	1.007	1.00
15_R	70_L	1.007	1.00
111_R	123_E	1.004	1.00
102_F	152_V	1.003	1.00
80_D	83_A	0.985	1.00
45_Y	60_R	0.983	1.00
34_P	46_L	0.977	1.00
100_L	152_V	0.971	1.00
36_G	81_L	0.968	1.00
43_R	62_D	0.956	1.00
12_E	69_V	0.948	1.00
138_L	142_A	0.942	1.00
119_Q	132_T	0.938	1.00
6_L	61_L	0.924	1.00
27_G	65_R	0.921	1.00
19_D	27_G	0.919	1.00
13_R	74_F	0.918	1.00
13_R	76_R	0.908	1.00
36_G	47_V	0.899	1.00
45_Y	58_T	0.882	1.00
103_S	106_A	0.878	1.00
162_E	165_R	0.875	1.00
18_F	67_V	0.874	1.00
156_E	159_E	0.872	1.00
146_L	164_V	0.860	1.00
88_S	93_E	0.859	1.00
139_E	143_R	0.856	1.00
107_A	111_R	0.854	1.00
145_L	164_V	0.841	1.00
49_Y	53_R	0.839	1.00
9_A	16_V	0.839	1.00
97_E	156_E	0.838	1.00
115_W	118_Q	0.828	1.00
47_V	58_T	0.828	1.00
88_S	91_V	0.814	1.00
96_V	138_L	0.807	1.00
148_F	152_V	0.805	1.00
22_S	26_E	0.805	1.00
47_V	84_Y	0.802	1.00
89_F	92_F	0.793	1.00
116_P	119_Q	0.793	1.00
166_E	169_R	0.790	1.00
139_E	142_A	0.787	1.00
96_V	137_D	0.785	1.00
39_F	44_W	0.784	1.00
108_R	111_R	0.779	1.00
95_P	136_A	0.777	1.00
164_V	168_A	0.774	1.00
88_S	92_F	0.771	1.00
121_E	130_R	0.765	1.00
85_L	88_S	0.761	1.00
6_L	64_I	0.760	1.00
107_A	129_V	0.754	1.00
98_V	141_L	0.754	1.00
36_G	79_F	0.754	1.00
135_V	141_L	0.750	1.00
120_I	132_T	0.749	1.00
154_V	161_R	0.746	1.00
38_V	47_V	0.745	1.00
105_E	108_R	0.742	1.00
87_R	91_V	0.741	1.00
25_G	28_T	0.740	1.00
106_A	109_Y	0.736	1.00
79_F	84_Y	0.734	1.00
102_F	148_F	0.734	1.00
22_S	25_G	0.734	1.00
58_T	84_Y	0.731	1.00
145_L	152_V	0.731	1.00
21_R	25_G	0.730	1.00
137_D	142_A	0.730	1.00
24_R	27_G	0.727	1.00
106_A	148_F	0.723	1.00
104_P	127_G	0.722	1.00
14_R	70_L	0.710	1.00
87_R	90_G	0.710	1.00
138_L	160_L	0.709	1.00
109_Y	113_R	0.707	1.00
146_L	168_A	0.706	1.00
7_A	11_R	0.704	1.00
2_V	67_V	0.700	1.00
22_S	28_T	0.696	1.00
8_E	14_R	0.691	1.00
83_A	87_R	0.691	1.00
35_Y	49_Y	0.689	1.00
6_L	46_L	0.683	1.00
50_D	59_F	0.682	1.00
98_V	135_V	0.681	1.00
122_E	130_R	0.677	1.00
102_F	106_A	0.676	1.00
70_L	73_R	0.669	1.00
31_T	52_D	0.667	1.00
118_Q	121_E	0.667	1.00
91_V	94_G	0.659	1.00
83_A	86_A	0.657	1.00
128_S	153_E	0.655	1.00
24_R	28_T	0.654	1.00
124_L	127_G	0.653	1.00
37_L	61_L	0.653	1.00
90_G	93_E	0.647	1.00
104_P	128_S	0.645	1.00
117_S	120_I	0.641	1.00
46_L	64_I	0.641	1.00
121_E	132_T	0.639	1.00
119_Q	122_E	0.638	1.00
121_E	124_L	0.638	1.00
35_Y	77_P	0.635	1.00
82_A	86_A	0.633	1.00
103_S	153_E	0.633	1.00
81_L	85_L	0.627	1.00
16_V	32_V	0.622	1.00
32_V	59_F	0.614	1.00
49_Y	55_D	0.611	1.00
20_Y	59_F	0.608	1.00
165_R	168_A	0.599	1.00
56_I	84_Y	0.598	1.00
63_R	112_E	0.593	1.00
140_E	144_W	0.590	1.00
87_R	95_P	0.588	1.00
35_Y	74_F	0.585	1.00
118_Q	122_E	0.584	1.00
144_W	148_F	0.581	1.00
159_E	163_E	0.580	1.00
3_L	7_A	0.580	1.00
104_P	129_V	0.578	1.00
116_P	120_I	0.578	1.00
21_R	24_R	0.577	1.00
96_V	135_V	0.573	1.00
47_V	56_I	0.571	1.00
30_R	57_R	0.571	1.00
4_E	8_E	0.569	1.00
10_I	37_L	0.565	1.00
84_Y	93_E	0.565	1.00
98_V	160_L	0.564	1.00
104_P	108_R	0.559	1.00
64_I	67_V	0.558	1.00
84_Y	87_R	0.557	1.00
122_E	125_D	0.556	1.00
164_V	167_R	0.555	1.00
100_L	133_L	0.555	1.00
138_L	141_L	0.553	1.00
82_A	85_L	0.544	1.00
23_A	63_R	0.538	1.00
143_R	147_S	0.537	1.00
4_E	7_A	0.537	1.00
21_R	26_E	0.536	1.00
39_F	42_G	0.536	1.00
104_P	107_A	0.533	1.00
159_E	162_E	0.532	1.00
70_L	74_F	0.531	1.00
10_I	13_R	0.530	1.00
102_F	107_A	0.528	1.00
20_Y	60_R	0.523	1.00
49_Y	56_I	0.520	1.00
137_D	159_E	0.520	1.00
18_F	48_A	0.519	1.00
111_R	122_E	0.516	1.00
29_E	66_S	0.515	1.00
145_L	154_V	0.514	1.00
139_E	167_R	0.512	1.00
137_D	140_E	0.511	1.00
114_P	117_S	0.509	1.00
96_V	99_R	0.507	1.00
154_V	160_L	0.505	1.00
76_R	79_F	0.504	1.00
10_I	34_P	0.500	1.00
105_E	109_Y	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sg5A	1	0.4302	29.5	0.889	Contact Map
3iarA	1	0.4884	3.7	0.927	Contact Map
1jr3A	3	0.9826	2.8	0.931	Contact Map
2e9xB	1	0.4535	2.7	0.932	Contact Map
1rblM	3	0.4767	2.6	0.933	Contact Map
1wddS	3	0.4535	2.5	0.933	Contact Map
4g1iA	1	0.3779	2.4	0.934	Contact Map
4k0mC	1	0.5116	2.3	0.935	Contact Map
1svdM	3	0.4709	2.2	0.935	Contact Map
2e52A	2	0.407	2.1	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.