DUF4065 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF4065 - Protein of unknown function (DUF4065)

PFAM:	PF13274	Sequences: LQKLLYYADFWHLAKYGRPLTGDRYEAWPYGPVVPELYDEIKGYGSNPIEIEEEEYWDEFISKKDYYEVEPLRDPDLSDLSEEELELLDEVIEKYGDLSAKELSDLTHEEGPWK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	114 (113)
Sequences:	20668 (18309)
Seq/√Len:	1722.3
META:	0.908

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_Y	34_V	3.262	1.00
12_H	16_Y	2.918	1.00
98_L	102_E	2.853	1.00
30_Y	104_S	2.651	1.00
81_S	84_E	2.453	1.00
8_A	20_L	2.351	1.00
8_A	88_L	2.229	1.00
28_W	33_V	2.179	1.00
32_P	107_T	2.019	1.00
12_H	87_L	2.010	1.00
101_K	104_S	2.003	1.00
26_E	35_P	1.875	1.00
98_L	106_L	1.862	1.00
9_D	21_T	1.835	1.00
100_A	104_S	1.832	1.00
35_P	39_D	1.827	1.00
80_L	84_E	1.769	1.00
99_S	102_E	1.755	1.00
10_F	14_A	1.640	1.00
4_L	95_Y	1.602	1.00
9_D	25_Y	1.595	1.00
9_D	19_P	1.571	1.00
7_Y	106_L	1.571	1.00
3_K	108_H	1.568	1.00
87_L	91_V	1.558	1.00
90_E	94_K	1.540	1.00
38_Y	42_K	1.502	1.00
11_W	90_E	1.474	1.00
95_Y	106_L	1.466	1.00
11_W	15_K	1.461	1.00
23_D	36_E	1.427	1.00
95_Y	98_L	1.370	1.00
16_Y	83_E	1.348	1.00
15_K	90_E	1.343	1.00
15_K	87_L	1.329	1.00
12_H	20_L	1.328	1.00
101_K	105_D	1.311	1.00
11_W	14_A	1.292	1.00
11_W	95_Y	1.269	1.00
7_Y	110_E	1.269	1.00
5_L	37_L	1.235	1.00
92_I	96_G	1.230	1.00
19_P	22_G	1.221	1.00
16_Y	87_L	1.194	1.00
11_W	94_K	1.186	1.00
89_D	92_I	1.131	1.00
76_D	79_D	1.125	1.00
67_Y	70_E	1.121	1.00
10_F	112_P	1.082	1.00
85_L	89_D	1.075	1.00
39_D	42_K	1.072	1.00
11_W	87_L	1.063	1.00
53_E	57_W	1.012	1.00
37_L	45_G	1.004	1.00
84_E	87_L	1.004	1.00
102_E	106_L	0.986	1.00
20_L	84_E	0.968	1.00
71_P	75_P	0.957	1.00
42_K	45_G	0.952	1.00
80_L	85_L	0.944	1.00
68_E	71_P	0.937	1.00
95_Y	103_L	0.924	1.00
80_L	88_L	0.917	1.00
66_Y	69_V	0.914	1.00
86_E	90_E	0.903	1.00
12_H	84_E	0.896	1.00
23_D	34_V	0.895	1.00
21_T	25_Y	0.895	1.00
64_K	67_Y	0.886	1.00
75_P	78_S	0.881	1.00
21_T	34_V	0.870	1.00
36_E	39_D	0.865	1.00
4_L	91_V	0.858	1.00
9_D	20_L	0.852	1.00
45_G	49_I	0.851	1.00
72_L	75_P	0.851	1.00
8_A	91_V	0.843	1.00
104_S	108_H	0.833	1.00
7_Y	107_T	0.829	1.00
44_Y	47_N	0.819	1.00
71_P	74_D	0.816	1.00
60_F	63_K	0.812	1.00
10_F	13_L	0.811	1.00
5_L	34_V	0.811	1.00
7_Y	91_V	0.810	1.00
87_L	90_E	0.807	1.00
59_E	63_K	0.806	1.00
18_R	84_E	0.796	1.00
65_D	68_E	0.791	1.00
37_L	40_E	0.788	1.00
49_I	53_E	0.781	1.00
51_I	54_E	0.779	1.00
102_E	105_D	0.777	1.00
105_D	109_E	0.766	1.00
94_K	98_L	0.750	1.00
63_K	66_Y	0.750	1.00
6_Y	10_F	0.743	1.00
9_D	12_H	0.743	1.00
28_W	35_P	0.740	1.00
33_V	108_H	0.740	1.00
106_L	109_E	0.737	1.00
9_D	13_L	0.731	1.00
67_Y	71_P	0.730	1.00
65_D	70_E	0.723	1.00
12_H	83_E	0.723	1.00
83_E	87_L	0.718	1.00
69_V	72_L	0.717	1.00
74_D	77_L	0.714	1.00
13_L	19_P	0.714	1.00
68_E	72_L	0.714	1.00
2_Q	5_L	0.711	1.00
30_Y	101_K	0.707	1.00
37_L	42_K	0.700	1.00
73_R	77_L	0.698	1.00
2_Q	38_Y	0.694	1.00
82_E	85_L	0.693	1.00
41_I	53_E	0.691	1.00
5_L	25_Y	0.684	1.00
2_Q	34_V	0.684	1.00
16_Y	84_E	0.683	1.00
41_I	44_Y	0.682	1.00
54_E	57_W	0.682	1.00
36_E	40_E	0.682	1.00
66_Y	71_P	0.675	1.00
104_S	107_T	0.670	1.00
37_L	41_I	0.669	1.00
28_W	38_Y	0.663	1.00
2_Q	37_L	0.660	1.00
57_W	60_F	0.659	1.00
82_E	86_E	0.654	1.00
93_E	96_G	0.654	1.00
6_Y	112_P	0.646	1.00
40_E	44_Y	0.645	1.00
73_R	76_D	0.643	1.00
11_W	91_V	0.635	1.00
63_K	68_E	0.634	1.00
70_E	73_R	0.630	1.00
51_I	55_E	0.615	1.00
38_Y	41_I	0.613	1.00
5_L	8_A	0.604	1.00
59_E	62_S	0.599	1.00
90_E	93_E	0.598	1.00
89_D	93_E	0.598	1.00
71_P	76_D	0.593	1.00
96_G	103_L	0.585	1.00
2_Q	33_V	0.584	1.00
52_E	57_W	0.583	1.00
63_K	67_Y	0.583	1.00
84_E	88_L	0.582	1.00
94_K	106_L	0.580	1.00
86_E	89_D	0.569	1.00
56_Y	59_E	0.568	1.00
53_E	56_Y	0.567	1.00
52_E	56_Y	0.566	1.00
66_Y	70_E	0.565	1.00
4_L	96_G	0.563	1.00
5_L	9_D	0.558	1.00
9_D	34_V	0.544	1.00
2_Q	7_Y	0.541	1.00
29_P	33_V	0.536	1.00
62_S	65_D	0.531	1.00
30_Y	100_A	0.528	1.00
56_Y	60_F	0.523	1.00
62_S	66_Y	0.520	1.00
91_V	95_Y	0.518	1.00
106_L	110_E	0.512	1.00
33_V	38_Y	0.507	1.00
69_V	73_R	0.504	1.00
48_P	52_E	0.500	1.00
77_L	85_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3mcaA	1	0	5.5	0.892	Contact Map
1fexA	1	0.3421	5.1	0.894	Contact Map
4gc8A	1	0.3158	4.9	0.894	Contact Map
1x46A	1	0.3596	4.7	0.896	Contact Map
3ctzA	2	0.9649	4.4	0.897	Contact Map
1xkrA	1	0.3333	4.3	0.898	Contact Map
2zetC	1	0.3509	4.1	0.899	Contact Map
4cc9B	1	0.2456	3.7	0.9	Contact Map
2k4bA	1	0.3158	3.4	0.902	Contact Map
1vw4S	1	0	3.4	0.903	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.