TerB_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TerB_N - TerB N-terminal domain

PFAM:	PF13208	Sequences: PPGESVTVAGRTIPGGMVYVGSLSSYGYGRSDEPSFIDPALFMADFEDDYDYSGPFMGYWPSYSSMSPEQRRAYLTWLAKGRRGEIPDTSIGYVFLYFYGLERRIGVDSPEDGLEKLAEFWAIYAELDRLLPIWGKDYSFYGYASSFLDFAELLRLDEEAYYPLPPPEEASDYELPLSLRLALGQYAADFYKDGGEPLPADWALVWALLDPEYRLRTPA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	219 (203)
Sequences:	1459 (1279)
Seq/√Len:	89.7
META:	0.788

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_Y	95_F	3.236	1.00
127_L	147_F	3.222	1.00
95_F	99_Y	3.069	1.00
94_V	120_F	3.030	1.00
101_L	123_I	2.843	1.00
57_M	90_S	2.714	1.00
61_P	99_Y	2.658	1.00
11_R	76_T	2.644	1.00
41_L	44_A	2.562	1.00
95_F	143_Y	2.464	1.00
131_L	144_A	2.443	1.00
54_G	90_S	2.427	1.00
59_Y	99_Y	2.396	1.00
66_M	96_L	2.390	1.00
187_A	198_L	2.319	1.00
17_M	20_V	2.309	1.00
73_A	89_T	2.222	1.00
23_L	28_Y	2.185	1.00
73_A	93_Y	2.161	1.00
92_G	95_F	2.150	1.00
104_R	138_Y	2.119	1.00
56_F	70_Q	2.109	1.00
95_F	130_L	2.082	1.00
182_A	202_W	2.078	1.00
113_G	138_Y	2.062	1.00
121_W	128_D	2.049	1.00
43_M	75_L	2.036	1.00
112_D	116_K	1.906	1.00
17_M	21_G	1.887	1.00
44_A	72_R	1.807	1.00
16_G	19_Y	1.789	1.00
67_S	70_Q	1.777	1.00
59_Y	143_Y	1.771	1.00
11_R	72_R	1.691	1.00
84_G	88_D	1.624	1.00
128_D	152_E	1.611	1.00
83_R	129_R	1.580	1.00
176_P	179_L	1.568	1.00
142_G	146_S	1.567	1.00
60_W	143_Y	1.544	1.00
72_R	76_T	1.529	1.00
59_Y	92_G	1.528	1.00
56_F	66_M	1.487	1.00
60_W	99_Y	1.485	1.00
104_R	107_V	1.484	1.00
98_F	117_L	1.476	1.00
57_M	66_M	1.467	1.00
105_I	120_F	1.457	0.99
60_W	95_F	1.449	0.99
61_P	92_G	1.438	0.99
13_I	16_G	1.425	0.99
186_Y	202_W	1.383	0.99
110_P	116_K	1.348	0.99
56_F	61_P	1.342	0.99
162_Y	185_Q	1.322	0.99
139_S	143_Y	1.313	0.99
82_R	97_Y	1.309	0.99
23_L	26_Y	1.308	0.99
104_R	113_G	1.302	0.99
35_S	64_S	1.294	0.99
140_F	144_A	1.294	0.99
177_L	181_L	1.265	0.98
14_P	17_M	1.261	0.98
33_E	103_R	1.254	0.98
9_A	43_M	1.252	0.98
66_M	70_Q	1.249	0.98
7_T	10_G	1.246	0.98
51_D	54_G	1.245	0.98
18_V	37_I	1.237	0.98
91_I	94_V	1.234	0.98
60_W	139_S	1.227	0.98
24_S	29_G	1.221	0.98
23_L	27_G	1.204	0.98
131_L	141_Y	1.199	0.98
105_I	147_F	1.184	0.98
48_D	72_R	1.184	0.98
131_L	135_G	1.168	0.97
24_S	27_G	1.167	0.97
15_G	18_V	1.166	0.97
8_V	13_I	1.159	0.97
6_V	20_V	1.156	0.97
35_S	39_P	1.147	0.97
129_R	133_I	1.145	0.97
107_V	113_G	1.140	0.97
92_G	99_Y	1.136	0.97
90_S	138_Y	1.133	0.97
55_P	90_S	1.112	0.97
14_P	18_V	1.108	0.97
59_Y	139_S	1.100	0.96
212_E	217_T	1.100	0.96
61_P	143_Y	1.098	0.96
38_D	41_L	1.084	0.96
50_Y	72_R	1.072	0.96
25_S	28_Y	1.070	0.96
48_D	76_T	1.066	0.96
87_P	94_V	1.063	0.96
24_S	28_Y	1.054	0.95
91_I	130_L	1.051	0.95
90_S	93_Y	1.048	0.95
54_G	73_A	1.046	0.95
16_G	21_G	1.040	0.95
92_G	130_L	1.037	0.95
176_P	184_G	1.022	0.95
126_E	129_R	1.016	0.94
59_Y	130_L	1.010	0.94
47_E	126_E	1.009	0.94
205_V	210_D	1.008	0.94
173_Y	176_P	1.006	0.94
98_F	120_F	0.997	0.94
78_L	100_G	0.992	0.94
146_S	149_D	0.979	0.93
47_E	83_R	0.977	0.93
113_G	116_K	0.955	0.92
43_M	46_F	0.941	0.92
115_E	119_E	0.941	0.92
113_G	121_W	0.940	0.92
87_P	134_W	0.937	0.92
203_A	207_A	0.928	0.91
13_I	17_M	0.927	0.91
165_P	170_A	0.923	0.91
179_L	183_L	0.922	0.91
81_G	97_Y	0.918	0.91
19_Y	87_P	0.914	0.91
99_Y	143_Y	0.910	0.90
97_Y	116_K	0.903	0.90
44_A	69_E	0.901	0.90
102_E	144_A	0.900	0.90
52_Y	73_A	0.900	0.90
202_W	210_D	0.897	0.90
185_Q	189_D	0.889	0.89
166_P	202_W	0.875	0.89
166_P	169_E	0.870	0.88
54_G	70_Q	0.864	0.88
16_G	20_V	0.864	0.88
120_F	124_Y	0.855	0.87
105_I	151_A	0.847	0.87
137_D	141_Y	0.844	0.87
128_D	132_P	0.840	0.86
11_R	15_G	0.835	0.86
52_Y	76_T	0.835	0.86
73_A	90_S	0.834	0.86
37_I	41_L	0.832	0.86
150_F	154_L	0.823	0.85
184_G	188_A	0.813	0.85
201_D	209_L	0.811	0.84
186_Y	199_P	0.807	0.84
14_P	20_V	0.803	0.84
119_E	123_I	0.802	0.84
91_I	140_F	0.802	0.84
51_D	73_A	0.799	0.84
197_P	203_A	0.795	0.83
84_G	186_Y	0.793	0.83
74_Y	78_L	0.793	0.83
124_Y	151_A	0.791	0.83
177_L	188_A	0.790	0.83
99_Y	131_L	0.789	0.83
8_V	18_V	0.789	0.83
15_G	19_Y	0.786	0.83
70_Q	93_Y	0.781	0.82
43_M	68_P	0.780	0.82
61_P	96_L	0.776	0.82
113_G	117_L	0.768	0.81
84_G	149_D	0.763	0.81
98_F	102_E	0.762	0.81
63_Y	82_R	0.758	0.80
196_E	199_P	0.757	0.80
92_G	139_S	0.751	0.80
198_L	213_Y	0.748	0.79
82_R	183_L	0.747	0.79
118_A	122_A	0.746	0.79
38_D	126_E	0.740	0.79
61_P	95_F	0.739	0.78
89_T	93_Y	0.736	0.78
7_T	12_T	0.734	0.78
57_M	60_W	0.734	0.78
125_A	155_R	0.733	0.78
212_E	215_L	0.723	0.77
53_S	189_D	0.719	0.77
76_T	80_K	0.719	0.77
52_Y	69_E	0.713	0.76
52_Y	89_T	0.712	0.76
202_W	205_V	0.711	0.76
107_V	138_Y	0.709	0.76
20_V	36_F	0.705	0.75
47_E	119_E	0.695	0.74
92_G	143_Y	0.694	0.74
84_G	87_P	0.693	0.74
200_A	204_L	0.689	0.73
203_A	206_W	0.685	0.73
57_M	143_Y	0.685	0.73
55_P	152_E	0.682	0.73
12_T	15_G	0.680	0.72
54_G	72_R	0.675	0.72
99_Y	102_E	0.675	0.72
19_Y	98_F	0.675	0.72
55_P	58_G	0.674	0.72
182_A	186_Y	0.672	0.72
80_K	87_P	0.670	0.71
97_Y	120_F	0.669	0.71
147_F	151_A	0.668	0.71
186_Y	189_D	0.664	0.71
52_Y	93_Y	0.662	0.70
78_L	103_R	0.662	0.70
39_P	71_R	0.660	0.70
6_V	12_T	0.659	0.70
91_I	95_F	0.658	0.70
54_G	57_M	0.649	0.69
105_I	124_Y	0.649	0.69
66_M	143_Y	0.649	0.69
46_F	71_R	0.649	0.69
61_P	139_S	0.646	0.69
184_G	187_A	0.642	0.68
80_K	83_R	0.637	0.68
66_M	138_Y	0.636	0.67
119_E	122_A	0.636	0.67
73_A	76_T	0.634	0.67
65_S	178_S	0.632	0.67
35_S	103_R	0.631	0.67
98_F	127_L	0.628	0.66
14_P	21_G	0.625	0.66
32_D	65_S	0.624	0.66
207_A	213_Y	0.624	0.66
204_L	208_L	0.621	0.66
61_P	140_F	0.621	0.66
207_A	215_L	0.617	0.65
123_I	130_L	0.613	0.65
25_S	29_G	0.610	0.64
40_A	63_Y	0.610	0.64
83_R	133_I	0.609	0.64
34_P	38_D	0.608	0.64
99_Y	140_F	0.608	0.64
36_F	40_A	0.605	0.64
57_M	61_P	0.601	0.63
95_F	126_E	0.599	0.63
57_M	70_Q	0.599	0.63
11_R	14_P	0.596	0.62
152_E	155_R	0.594	0.62
21_G	39_P	0.593	0.62
11_R	17_M	0.592	0.62
18_V	22_S	0.587	0.61
20_V	35_S	0.586	0.61
87_P	133_I	0.586	0.61
97_Y	213_Y	0.582	0.61
165_P	172_D	0.580	0.60
78_L	102_E	0.579	0.60
57_M	95_F	0.577	0.60
26_Y	32_D	0.576	0.60
81_G	102_E	0.575	0.60
17_M	97_Y	0.574	0.60
12_T	22_S	0.571	0.59
26_Y	31_S	0.570	0.59
57_M	92_G	0.570	0.59
74_Y	101_L	0.569	0.59
104_R	147_F	0.567	0.59
80_K	84_G	0.565	0.58
145_S	153_L	0.564	0.58
98_F	130_L	0.562	0.58
214_R	217_T	0.562	0.58
169_E	175_L	0.561	0.58
78_L	106_G	0.554	0.57
175_L	184_G	0.553	0.57
205_V	209_L	0.551	0.56
33_E	36_F	0.551	0.56
81_G	98_F	0.550	0.56
56_F	92_G	0.550	0.56
32_D	167_P	0.549	0.56
45_D	79_A	0.547	0.56
94_V	134_W	0.545	0.56
92_G	137_D	0.545	0.56
127_L	144_A	0.544	0.56
36_F	39_P	0.543	0.55
117_L	121_W	0.541	0.55
119_E	126_E	0.540	0.55
123_I	147_F	0.540	0.55
114_L	135_G	0.536	0.54
46_F	75_L	0.536	0.54
40_A	105_I	0.534	0.54
36_F	103_R	0.532	0.54
39_P	42_F	0.531	0.54
95_F	140_F	0.531	0.54
169_E	173_Y	0.529	0.53
96_L	206_W	0.526	0.53
52_Y	70_Q	0.526	0.53
35_S	202_W	0.526	0.53
167_P	206_W	0.525	0.53
53_S	83_R	0.523	0.53
148_L	157_D	0.521	0.52
110_P	114_L	0.521	0.52
11_R	75_L	0.519	0.52
99_Y	139_S	0.516	0.52
26_Y	29_G	0.514	0.51
166_P	205_V	0.514	0.51
123_I	151_A	0.512	0.51
211_P	215_L	0.511	0.51
88_D	127_L	0.508	0.51
81_G	100_G	0.507	0.50
19_Y	22_S	0.505	0.50
106_G	113_G	0.505	0.50
45_D	141_Y	0.505	0.50
61_P	91_I	0.502	0.50
91_I	144_A	0.502	0.50
185_Q	188_A	0.501	0.50
43_M	72_R	0.501	0.50
57_M	93_Y	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3n75A	4	0.2603	6.5	0.954	Contact Map
1yvlA	3	0.5205	3	0.961	Contact Map
1sx5A	2	0.379	2.8	0.961	Contact Map
1yewA	3	0.2694	2.6	0.962	Contact Map
3kmhA	2	0.2557	2.5	0.962	Contact Map
3nttA	6	0	2.2	0.964	Contact Map
3vavA	4	0.3653	2.1	0.964	Contact Map
4pf1A	4	0.2557	2	0.965	Contact Map
1oy0A	4	0.3562	2	0.965	Contact Map
2p18A	1	0.5342	1.7	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.