DUF3873 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3873 - Domain of unknown function, B. Theta Gene description (DUF3873)

PFAM:	PF12989	Sequences: TKMTKNGVSTCTTPGQEQYETFTSGHRRKRKKYYQYDYRHTDGELFSCVAPTLEECREKRDEWLKKKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	68 (64)
Sequences:	519 (330)
Seq/√Len:	41.2
META:	0.929

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_A	59_K	4.013	1.00
21_T	34_Y	3.048	1.00
4_T	8_V	2.706	1.00
50_A	56_C	2.273	1.00
26_H	29_K	1.975	0.99
22_F	49_V	1.942	0.99
44_E	67_K	1.927	0.99
37_D	47_S	1.819	0.98
3_M	8_V	1.791	0.98
11_C	18_Q	1.777	0.98
58_E	62_E	1.751	0.98
17_E	36_Y	1.626	0.96
4_T	11_C	1.532	0.95
42_D	67_K	1.521	0.94
37_D	45_L	1.486	0.94
13_T	16_Q	1.450	0.93
53_L	56_C	1.399	0.91
52_T	56_C	1.398	0.91
26_H	31_K	1.220	0.85
11_C	14_P	1.211	0.84
17_E	46_F	1.198	0.84
10_T	18_Q	1.168	0.82
4_T	18_Q	1.162	0.82
36_Y	46_F	1.158	0.81
21_T	32_K	1.142	0.81
3_M	20_E	1.114	0.79
19_Y	53_L	1.097	0.78
34_Y	56_C	1.093	0.77
24_S	33_Y	1.074	0.76
3_M	56_C	1.062	0.75
55_E	58_E	1.054	0.75
40_H	64_L	1.048	0.74
52_T	55_E	1.028	0.73
5_K	8_V	0.993	0.70
62_E	66_K	0.958	0.68
59_K	62_E	0.944	0.66
55_E	59_K	0.943	0.66
6_N	52_T	0.940	0.66
33_Y	49_V	0.930	0.65
13_T	40_H	0.921	0.64
35_Q	47_S	0.908	0.63
22_F	33_Y	0.903	0.63
4_T	20_E	0.890	0.62
57_R	61_D	0.876	0.61
24_S	29_K	0.876	0.61
3_M	10_T	0.857	0.59
35_Q	39_R	0.848	0.58
23_T	33_Y	0.816	0.55
54_E	58_E	0.806	0.54
14_P	18_Q	0.800	0.54
57_R	60_R	0.798	0.53
23_T	27_R	0.785	0.52
13_T	21_T	0.784	0.52
8_V	20_E	0.784	0.52
39_R	45_L	0.783	0.52
37_D	63_W	0.751	0.49
25_G	29_K	0.741	0.48
41_T	54_E	0.733	0.47
41_T	64_L	0.725	0.47
16_Q	33_Y	0.701	0.44
40_H	67_K	0.700	0.44
10_T	16_Q	0.697	0.44
23_T	32_K	0.694	0.44
26_H	65_K	0.678	0.42
5_K	55_E	0.676	0.42
30_R	58_E	0.668	0.41
3_M	11_C	0.660	0.41
38_Y	41_T	0.659	0.41
23_T	26_H	0.646	0.39
9_S	35_Q	0.636	0.39
54_E	65_K	0.634	0.38
17_E	57_R	0.631	0.38
7_G	37_D	0.613	0.37
44_E	66_K	0.602	0.36
35_Q	49_V	0.597	0.35
22_F	27_R	0.587	0.34
20_E	45_L	0.569	0.33
4_T	10_T	0.556	0.32
36_Y	48_C	0.552	0.31
41_T	65_K	0.542	0.31
38_Y	51_P	0.540	0.31
23_T	30_R	0.539	0.30
19_Y	27_R	0.535	0.30
25_G	28_R	0.533	0.30
27_R	31_K	0.532	0.30
25_G	30_R	0.532	0.30
39_R	47_S	0.528	0.30
17_E	48_C	0.527	0.30
31_K	51_P	0.523	0.29
5_K	58_E	0.515	0.29
30_R	59_K	0.513	0.28
38_Y	60_R	0.512	0.28
26_H	48_C	0.512	0.28
20_E	49_V	0.508	0.28
52_T	67_K	0.502	0.28
60_R	63_W	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3jtzA	2	0.9559	9.8	0.914	Contact Map
3ju0A	1	0.9559	7.1	0.919	Contact Map
3gf8A	1	0.2059	4.8	0.925	Contact Map
2l63A	1	0.4265	2.9	0.933	Contact Map
2iu4A	2	0.5294	2.6	0.935	Contact Map
3c64A	2	0.5588	2.5	0.935	Contact Map
4om7A	2	0.4853	2.4	0.936	Contact Map
3rx6A	2	0.3235	2.1	0.937	Contact Map
3lxrF	1	0.7059	2.1	0.938	Contact Map
1bx7A	1	0.25	2.1	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.