AtpR - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AtpR - N-ATPase, AtpR subunit

PFAM:	PF12966	Sequences: MSLALALLAGLLLGAFFFGGLWWTVRRLVSSKRPALWFLGSLLLRTALVLAGFYLVAGGGWERLLACLLGFLLARLIVTRLTRPP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	85 (81)
Sequences:	4106 (3178)
Seq/√Len:	353.1
META:	0.909

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_L	52_G	3.438	1.00
49_V	71_F	3.102	1.00
56_V	67_C	3.044	1.00
28_L	38_F	2.957	1.00
60_G	63_R	2.595	1.00
53_F	71_F	2.135	1.00
16_F	48_L	2.012	1.00
42_L	46_T	1.958	1.00
17_F	49_V	1.902	1.00
7_L	73_L	1.824	1.00
22_W	26_R	1.821	1.00
74_A	78_V	1.686	1.00
76_L	79_T	1.654	1.00
20_G	24_T	1.633	1.00
78_V	82_T	1.618	1.00
24_T	41_S	1.599	1.00
11_L	74_A	1.521	1.00
57_A	64_L	1.518	1.00
20_G	41_S	1.481	1.00
21_L	25_V	1.417	1.00
19_G	23_W	1.376	1.00
6_A	66_A	1.358	1.00
59_G	63_R	1.311	1.00
13_L	49_V	1.304	1.00
9_A	52_G	1.247	1.00
32_K	36_L	1.233	1.00
58_G	63_R	1.229	1.00
46_T	50_L	1.225	1.00
49_V	53_F	1.197	1.00
3_L	66_A	1.175	1.00
31_S	37_W	1.160	1.00
14_G	74_A	1.114	1.00
6_A	56_V	1.101	1.00
6_A	67_C	1.096	1.00
51_A	55_L	1.086	1.00
7_L	66_A	1.071	1.00
68_L	72_L	1.037	1.00
16_F	20_G	1.031	1.00
41_S	45_R	1.018	1.00
78_V	81_L	0.992	1.00
36_L	40_G	0.980	1.00
14_G	18_F	0.976	1.00
37_W	41_S	0.964	1.00
29_V	37_W	0.961	1.00
70_G	74_A	0.956	1.00
53_F	67_C	0.951	1.00
28_L	37_W	0.937	1.00
6_A	59_G	0.934	1.00
31_S	34_P	0.932	1.00
7_L	11_L	0.930	1.00
76_L	80_R	0.907	1.00
20_G	23_W	0.906	1.00
16_F	49_V	0.892	1.00
79_T	82_T	0.883	1.00
11_L	15_A	0.866	1.00
15_A	19_G	0.854	1.00
61_W	65_L	0.850	1.00
57_A	67_C	0.850	1.00
57_A	63_R	0.844	1.00
7_L	70_G	0.832	1.00
50_L	71_F	0.828	1.00
57_A	60_G	0.809	1.00
77_I	80_R	0.795	1.00
77_I	81_L	0.789	1.00
19_G	22_W	0.769	1.00
59_G	64_L	0.760	1.00
9_A	56_V	0.749	1.00
23_W	26_R	0.744	1.00
72_L	76_L	0.738	1.00
80_R	83_R	0.735	1.00
4_A	65_L	0.735	1.00
54_Y	58_G	0.711	0.99
40_G	44_L	0.708	0.99
46_T	71_F	0.704	0.99
15_A	74_A	0.699	0.99
38_F	42_L	0.695	0.99
4_A	8_L	0.679	0.99
47_A	51_A	0.672	0.99
7_L	12_L	0.667	0.99
68_L	79_T	0.667	0.99
13_L	24_T	0.666	0.99
50_L	54_Y	0.661	0.99
53_F	64_L	0.651	0.99
28_L	31_S	0.648	0.99
24_T	27_R	0.646	0.99
48_L	55_L	0.640	0.99
27_R	36_L	0.639	0.99
33_R	36_L	0.639	0.99
56_V	63_R	0.639	0.99
55_L	58_G	0.638	0.99
48_L	52_G	0.637	0.99
47_A	62_E	0.635	0.99
35_A	38_F	0.631	0.99
30_S	80_R	0.627	0.98
16_F	26_R	0.625	0.98
24_T	45_R	0.625	0.98
35_A	39_L	0.624	0.98
28_L	41_S	0.611	0.98
7_L	69_L	0.610	0.98
65_L	69_L	0.608	0.98
14_G	70_G	0.607	0.98
12_L	15_A	0.601	0.98
31_S	39_L	0.601	0.98
17_F	20_G	0.597	0.98
25_V	29_V	0.591	0.98
27_R	30_S	0.588	0.98
75_R	80_R	0.587	0.98
21_L	24_T	0.581	0.98
58_G	62_E	0.581	0.98
17_F	46_T	0.567	0.97
15_A	81_L	0.560	0.97
5_L	83_R	0.551	0.97
11_L	32_K	0.542	0.96
13_L	34_P	0.528	0.96
18_F	72_L	0.521	0.95
27_R	37_W	0.520	0.95
66_A	75_R	0.515	0.95
20_G	39_L	0.512	0.95
51_A	58_G	0.512	0.95
38_F	46_T	0.505	0.95
6_A	19_G	0.504	0.94
8_L	11_L	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4rngA	2	0.9647	1.6	0.896	Contact Map
4czbA	2	0.8588	1.5	0.898	Contact Map
2x2zA	1	0	1.4	0.9	Contact Map
3j1zP	8	0.7529	1.3	0.901	Contact Map
4zw9A	1	0.9765	1.2	0.902	Contact Map
2jwaA	2	0.4	1.2	0.904	Contact Map
1pw4A	1	1	1	0.909	Contact Map
2cfqA	1	0.9882	0.9	0.91	Contact Map
1scfA	4	0	0.9	0.911	Contact Map
4pypA	1	1	0.9	0.911	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.