DUF3846 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3846 - Domain of unknown function (DUF3846)

PFAM:	PF12957	Sequences: VLVVEPGKEPEVVEIENTLEALQKAVGGYIEAVYPLDDGVALVCNEEGKLKGLPLNRALGDGGIYDIIVGTFFIVGLDDEEGDFTSLTDEQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	91 (88)
Sequences:	4121 (3434)
Seq/√Len:	366.1
META:	0.94

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_K	66_D	2.930	1.00
45_N	51_K	2.763	1.00
45_N	53_L	2.429	1.00
47_E	50_L	2.373	1.00
19_L	23_Q	2.358	1.00
43_V	84_F	2.344	1.00
31_E	46_E	2.046	1.00
3_V	25_A	1.890	1.00
32_A	41_A	1.848	1.00
18_T	21_A	1.692	1.00
43_V	75_V	1.670	1.00
6_P	71_T	1.659	1.00
4_V	72_F	1.632	1.00
5_E	8_K	1.630	1.00
42_L	72_F	1.602	1.00
3_V	13_V	1.580	1.00
47_E	51_K	1.553	1.00
22_L	73_F	1.551	1.00
78_D	85_T	1.520	1.00
5_E	71_T	1.506	1.00
19_L	30_I	1.503	1.00
53_L	71_T	1.481	1.00
49_K	69_V	1.477	1.00
29_Y	46_E	1.466	1.00
44_C	48_G	1.457	1.00
42_L	68_I	1.454	1.00
5_E	11_E	1.405	1.00
13_V	25_A	1.348	1.00
16_E	21_A	1.334	1.00
26_V	45_N	1.281	1.00
3_V	71_T	1.279	1.00
68_I	72_F	1.278	1.00
42_L	74_I	1.222	1.00
49_K	67_I	1.211	1.00
32_A	43_V	1.207	1.00
3_V	11_E	1.204	1.00
23_Q	26_V	1.168	1.00
44_C	72_F	1.160	1.00
32_A	46_E	1.157	1.00
40_V	74_I	1.154	1.00
48_G	69_V	1.153	1.00
75_V	84_F	1.146	1.00
40_V	76_G	1.137	1.00
41_A	77_L	1.133	1.00
32_A	84_F	1.103	1.00
21_A	24_K	1.076	1.00
21_A	25_A	1.069	1.00
77_L	85_T	1.067	1.00
20_E	23_Q	1.065	1.00
76_G	88_T	1.055	1.00
25_A	73_F	1.031	1.00
57_R	72_F	1.012	1.00
43_V	73_F	1.010	1.00
58_A	61_D	1.002	1.00
23_Q	28_G	0.994	1.00
29_Y	47_E	0.978	1.00
4_V	74_I	0.969	1.00
55_L	69_V	0.928	1.00
28_G	31_E	0.927	1.00
30_I	43_V	0.913	1.00
41_A	84_F	0.911	1.00
55_L	67_I	0.911	1.00
15_I	25_A	0.910	1.00
76_G	85_T	0.910	1.00
62_G	65_Y	0.872	1.00
5_E	9_E	0.859	1.00
23_Q	30_I	0.858	1.00
4_V	57_R	0.835	1.00
20_E	24_K	0.828	1.00
22_L	30_I	0.817	1.00
23_Q	29_Y	0.811	1.00
28_G	45_N	0.802	1.00
27_G	71_T	0.797	1.00
15_I	21_A	0.794	1.00
78_D	82_G	0.785	1.00
58_A	64_I	0.766	1.00
79_D	82_G	0.728	1.00
27_G	51_K	0.704	0.99
7_G	10_P	0.701	0.99
48_G	53_L	0.700	0.99
2_L	10_P	0.699	0.99
5_E	10_P	0.697	0.99
79_D	83_D	0.692	0.99
17_N	21_A	0.690	0.99
78_D	83_D	0.667	0.99
31_E	44_C	0.666	0.99
4_V	8_K	0.662	0.99
33_V	44_C	0.653	0.99
19_L	22_L	0.651	0.99
59_L	72_F	0.638	0.99
33_V	68_I	0.632	0.99
2_L	87_L	0.630	0.99
31_E	45_N	0.627	0.99
60_G	64_I	0.620	0.99
56_N	69_V	0.606	0.98
7_G	54_P	0.605	0.98
40_V	87_L	0.604	0.98
35_P	41_A	0.603	0.98
27_G	45_N	0.602	0.98
3_V	73_F	0.576	0.98
28_G	32_A	0.575	0.98
33_V	42_L	0.575	0.98
77_L	83_D	0.575	0.98
50_L	69_V	0.574	0.98
8_K	11_E	0.573	0.98
14_E	86_S	0.570	0.98
22_L	25_A	0.570	0.98
23_Q	45_N	0.563	0.97
26_V	73_F	0.562	0.97
44_C	49_K	0.562	0.97
44_C	68_I	0.558	0.97
19_L	31_E	0.554	0.97
13_V	73_F	0.553	0.97
26_V	71_T	0.551	0.97
79_D	85_T	0.549	0.97
59_L	65_Y	0.548	0.97
35_P	38_D	0.548	0.97
15_I	18_T	0.541	0.97
82_G	85_T	0.540	0.97
17_N	83_D	0.534	0.96
29_Y	32_A	0.521	0.96
33_V	59_L	0.516	0.96
53_L	56_N	0.516	0.96
26_V	30_I	0.514	0.95
50_L	53_L	0.514	0.95
41_A	75_V	0.512	0.95
22_L	43_V	0.509	0.95
45_N	48_G	0.506	0.95
3_V	9_E	0.504	0.95
8_K	12_V	0.503	0.95
30_I	45_N	0.501	0.95
22_L	75_V	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2dkhA	2	0.3516	10.5	0.882	Contact Map
3takA	2	0.6044	5.9	0.895	Contact Map
2ojpA	2	0.5934	5.3	0.898	Contact Map
2nuwA	3	0.5824	4.8	0.899	Contact Map
3eb2A	3	0.6154	4.8	0.9	Contact Map
4ur7A	3	0.6923	4.4	0.901	Contact Map
4hdeA	1	0.3407	4.4	0.902	Contact Map
1w3iA	3	0.5824	4.1	0.903	Contact Map
1s1dA	1	0.978	4	0.903	Contact Map
2pcqA	3	0.5495	3.8	0.904	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.