Kri1_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Kri1_C - KRI1-like family C-terminal

PFAM:	PF12936	Sequences: KKLEELVDEYYKLDYEDIIGDLPTRFKYREVSPNSFGLTAEEILLADDKELNQFVSLKKLAPYRDEEKKRKDKKKLGKKARLREWRKET	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	89 (86)
Sequences:	639 (453)
Seq/√Len:	48.8
META:	0.336

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_D	50_E	3.101	1.00
20_G	24_T	2.530	1.00
18_I	23_P	2.410	1.00
52_N	56_S	2.214	1.00
8_D	11_Y	2.109	1.00
17_D	21_D	2.060	1.00
59_K	64_R	1.954	0.99
16_E	19_I	1.926	0.99
82_L	86_R	1.907	0.99
30_E	33_P	1.874	0.99
2_K	5_E	1.750	0.99
11_Y	16_E	1.727	0.98
31_V	63_Y	1.674	0.98
40_A	45_L	1.670	0.98
78_K	85_W	1.646	0.98
40_A	43_I	1.604	0.98
76_L	80_A	1.574	0.97
15_Y	25_R	1.541	0.97
22_L	25_R	1.455	0.96
77_G	81_R	1.443	0.95
13_L	25_R	1.426	0.95
75_K	78_K	1.404	0.95
34_N	66_E	1.394	0.94
55_V	60_L	1.340	0.93
71_K	75_K	1.298	0.92
76_L	79_K	1.268	0.91
37_G	58_K	1.246	0.90
41_E	48_D	1.237	0.90
17_D	22_L	1.231	0.90
80_A	84_E	1.230	0.90
10_Y	15_Y	1.197	0.88
11_Y	14_D	1.191	0.88
20_G	23_P	1.178	0.88
10_Y	16_E	1.170	0.87
32_S	55_V	1.153	0.86
71_K	74_K	1.131	0.85
24_T	27_K	1.120	0.85
5_E	57_L	1.068	0.82
75_K	85_W	1.060	0.81
13_L	17_D	1.045	0.81
78_K	82_L	1.039	0.80
58_K	64_R	1.023	0.79
9_E	13_L	1.010	0.78
81_R	85_W	1.007	0.78
66_E	70_R	1.001	0.78
34_N	55_V	0.997	0.77
57_L	60_L	0.991	0.77
46_A	54_F	0.971	0.75
41_E	45_L	0.965	0.75
17_D	25_R	0.960	0.75
15_Y	24_T	0.956	0.74
21_D	24_T	0.948	0.74
31_V	45_L	0.942	0.73
82_L	85_W	0.940	0.73
14_D	17_D	0.938	0.73
16_E	21_D	0.936	0.73
9_E	12_K	0.933	0.72
6_L	15_Y	0.925	0.72
36_F	64_R	0.920	0.71
35_S	54_F	0.899	0.70
29_R	54_F	0.891	0.69
38_L	42_E	0.891	0.69
17_D	55_V	0.888	0.69
31_V	69_K	0.879	0.68
72_D	78_K	0.871	0.67
38_L	54_F	0.867	0.67
32_S	67_E	0.864	0.66
72_D	76_L	0.864	0.66
4_E	65_D	0.857	0.66
62_P	70_R	0.839	0.64
74_K	79_K	0.825	0.63
19_I	24_T	0.823	0.63
38_L	46_A	0.817	0.62
14_D	19_I	0.804	0.61
20_G	27_K	0.804	0.61
65_D	68_K	0.800	0.60
15_Y	20_G	0.794	0.60
2_K	22_L	0.788	0.59
46_A	77_G	0.787	0.59
84_E	87_K	0.778	0.58
54_F	61_A	0.742	0.55
54_F	69_K	0.730	0.54
46_A	72_D	0.718	0.52
43_I	68_K	0.714	0.52
18_I	44_L	0.710	0.52
35_S	53_Q	0.705	0.51
45_L	61_A	0.699	0.50
19_I	25_R	0.698	0.50
43_I	48_D	0.698	0.50
16_E	23_P	0.698	0.50
13_L	16_E	0.695	0.50
9_E	49_K	0.684	0.49
62_P	82_L	0.683	0.49
19_I	22_L	0.682	0.49
3_L	6_L	0.680	0.48
60_L	74_K	0.678	0.48
72_D	80_A	0.676	0.48
6_L	76_L	0.673	0.48
47_D	62_P	0.671	0.48
10_Y	14_D	0.651	0.46
74_K	78_K	0.648	0.45
22_L	50_E	0.647	0.45
27_K	30_E	0.641	0.45
17_D	24_T	0.629	0.43
42_E	46_A	0.628	0.43
48_D	61_A	0.623	0.43
10_Y	13_L	0.616	0.42
33_P	59_K	0.593	0.40
15_Y	19_I	0.593	0.40
17_D	23_P	0.591	0.40
28_Y	33_P	0.586	0.39
72_D	82_L	0.583	0.39
71_K	78_K	0.566	0.37
68_K	72_D	0.564	0.37
77_G	80_A	0.563	0.37
21_D	27_K	0.563	0.37
15_Y	23_P	0.562	0.37
49_K	53_Q	0.550	0.36
35_S	67_E	0.550	0.36
68_K	78_K	0.550	0.36
28_Y	31_V	0.545	0.35
49_K	66_E	0.542	0.35
70_R	74_K	0.534	0.34
4_E	72_D	0.532	0.34
26_F	29_R	0.510	0.32
81_R	84_E	0.508	0.32
14_D	20_G	0.507	0.32
15_Y	21_D	0.501	0.31
8_D	67_E	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1awcA	1	0.6067	11.5	0.918	Contact Map
3wtsC	1	0.5506	8.7	0.923	Contact Map
1gvjA	2	0.6067	7.8	0.924	Contact Map
3szrA	2	0.9101	6.6	0.927	Contact Map
1jrmA	1	0.573	5.6	0.929	Contact Map
3dptA	2	0.7079	3.5	0.936	Contact Map
4dhiB	1	0.9775	3.5	0.936	Contact Map
2q5zA	4	0.6404	3.4	0.936	Contact Map
1vx7g	1	0.3596	3.3	0.936	Contact Map
3a5tA	2	0.6067	3.2	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.