ThrE_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ThrE_2 - Threonine/Serine exporter, ThrE

PFAM:	PF12821	Sequences: QQVLAAALAAAGFAVLFNAPRRDLLWAALAGALGWLVRLLLLRLGLGPFLATFLAALVVGLLANLLARRLKTPATVFIVPGIIPLVPGVALYRALRDLVQGDLVSGLARGLEALLIALAIAAGLLLASLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	130 (126)
Sequences:	13833 (9346)
Seq/√Len:	832.6
META:	0.736

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_V	58_V	3.261	1.00
94_A	110_G	3.058	1.00
11_A	28_A	2.533	1.00
20_P	23_D	2.528	1.00
7_A	28_A	2.496	1.00
34_G	59_V	2.446	1.00
60_G	127_A	2.422	1.00
30_A	62_L	2.301	1.00
102_D	105_S	2.237	1.00
10_A	31_G	2.122	1.00
57_L	127_A	2.122	1.00
7_A	32_A	2.097	1.00
76_V	80_P	2.018	1.00
109_R	112_E	2.004	1.00
91_L	113_A	1.936	1.00
3_V	36_L	1.918	1.00
98_L	106_G	1.875	1.00
14_A	24_L	1.857	1.00
63_A	78_I	1.853	1.00
52_T	116_I	1.762	1.00
14_A	19_A	1.754	1.00
53_F	119_A	1.743	1.00
3_V	32_A	1.734	1.00
77_F	80_P	1.599	1.00
17_F	83_I	1.591	1.00
40_L	44_L	1.569	1.00
97_D	109_R	1.530	1.00
59_V	81_G	1.516	1.00
41_L	46_L	1.505	1.00
6_A	35_W	1.477	1.00
41_L	54_L	1.442	1.00
94_A	113_A	1.422	1.00
30_A	66_L	1.380	1.00
53_F	126_L	1.364	1.00
97_D	102_D	1.311	1.00
36_L	40_L	1.306	1.00
38_R	42_L	1.295	1.00
42_L	51_A	1.291	1.00
60_G	124_L	1.284	1.00
11_A	24_L	1.261	1.00
105_S	108_A	1.253	1.00
33_L	62_L	1.243	1.00
97_D	106_G	1.221	1.00
9_A	13_F	1.186	1.00
39_L	43_R	1.167	1.00
10_A	83_I	1.167	1.00
19_A	23_D	1.165	1.00
30_A	81_G	1.149	1.00
89_V	93_R	1.141	1.00
23_D	72_T	1.135	1.00
34_G	55_A	1.134	1.00
103_L	106_G	1.119	1.00
25_L	28_A	1.085	1.00
37_V	41_L	1.075	1.00
35_W	38_R	1.069	1.00
105_S	109_R	1.069	1.00
106_G	109_R	1.068	1.00
64_N	128_S	1.068	1.00
65_L	69_R	1.059	1.00
123_G	127_A	1.032	1.00
112_E	116_I	1.031	1.00
46_L	50_L	1.020	1.00
21_R	24_L	1.017	1.00
27_A	31_G	1.010	1.00
120_I	123_G	1.010	1.00
107_L	111_L	1.000	1.00
117_A	120_I	0.995	1.00
26_W	66_L	0.993	1.00
19_A	27_A	0.993	1.00
35_W	39_L	0.989	1.00
62_L	66_L	0.975	1.00
112_E	115_L	0.966	1.00
107_L	110_G	0.950	1.00
93_R	109_R	0.944	1.00
56_A	120_I	0.941	1.00
48_P	52_T	0.932	1.00
69_R	72_T	0.923	1.00
26_W	29_L	0.914	1.00
49_F	52_T	0.910	1.00
9_A	83_I	0.907	1.00
90_A	113_A	0.905	1.00
108_A	112_E	0.900	1.00
64_N	68_R	0.893	1.00
8_L	12_G	0.886	1.00
26_W	70_L	0.885	1.00
70_L	77_F	0.879	1.00
4_L	8_L	0.869	1.00
97_D	105_S	0.863	1.00
93_R	97_D	0.856	1.00
96_R	100_Q	0.856	1.00
67_A	74_A	0.849	1.00
72_T	77_F	0.847	1.00
90_A	112_E	0.846	1.00
67_A	71_K	0.844	1.00
4_L	7_A	0.832	1.00
53_F	57_L	0.822	1.00
37_V	55_A	0.818	1.00
41_L	51_A	0.809	1.00
64_N	74_A	0.803	1.00
13_F	16_L	0.801	1.00
12_G	15_V	0.800	1.00
49_F	112_E	0.778	1.00
66_L	69_R	0.776	1.00
40_L	43_R	0.775	1.00
25_L	29_L	0.771	1.00
73_P	92_Y	0.768	1.00
58_V	62_L	0.766	1.00
41_L	45_G	0.758	1.00
82_I	120_I	0.752	1.00
42_L	45_G	0.747	1.00
104_V	108_A	0.746	1.00
64_N	127_A	0.734	1.00
3_V	7_A	0.733	1.00
63_A	77_F	0.728	1.00
114_L	118_L	0.721	1.00
7_A	25_L	0.720	1.00
77_F	81_G	0.704	1.00
83_I	86_V	0.700	1.00
75_T	79_V	0.699	1.00
23_D	70_L	0.697	1.00
21_R	25_L	0.693	1.00
57_L	61_L	0.692	1.00
103_L	107_L	0.691	1.00
46_L	54_L	0.689	1.00
68_R	71_K	0.686	1.00
49_F	115_L	0.685	1.00
14_A	27_A	0.683	1.00
55_A	59_V	0.681	1.00
51_A	55_A	0.680	1.00
54_L	57_L	0.679	1.00
66_L	70_L	0.677	1.00
111_L	115_L	0.669	1.00
94_A	106_G	0.668	1.00
47_G	52_T	0.665	1.00
90_A	109_R	0.662	1.00
74_A	79_V	0.661	1.00
73_P	80_P	0.660	1.00
106_G	110_G	0.653	1.00
110_G	114_L	0.652	1.00
61_L	127_A	0.648	1.00
47_G	50_L	0.645	1.00
33_L	58_V	0.644	1.00
9_A	12_G	0.638	1.00
35_W	84_P	0.626	1.00
36_L	39_L	0.625	1.00
13_F	86_V	0.621	1.00
66_L	77_F	0.618	1.00
31_G	84_P	0.611	1.00
56_A	82_I	0.601	1.00
5_A	8_L	0.598	1.00
96_R	99_V	0.598	1.00
73_P	76_V	0.598	1.00
64_N	67_A	0.591	1.00
6_A	10_A	0.582	1.00
59_V	84_P	0.577	1.00
82_I	124_L	0.574	1.00
93_R	96_R	0.570	1.00
59_V	63_A	0.568	1.00
122_A	125_L	0.565	1.00
74_A	80_P	0.558	1.00
24_L	27_A	0.556	1.00
32_A	36_L	0.554	1.00
110_G	128_S	0.554	1.00
97_D	100_Q	0.554	1.00
75_T	80_P	0.553	1.00
57_L	123_G	0.552	1.00
90_A	94_A	0.551	1.00
11_A	15_V	0.550	1.00
42_L	48_P	0.546	1.00
41_L	44_L	0.540	1.00
46_L	51_A	0.539	1.00
53_F	122_A	0.538	1.00
79_V	93_R	0.537	1.00
37_V	40_L	0.535	1.00
115_L	118_L	0.533	1.00
98_L	110_G	0.523	1.00
106_G	115_L	0.519	1.00
45_G	48_P	0.518	1.00
31_G	81_G	0.518	1.00
67_A	70_L	0.517	1.00
57_L	126_L	0.516	1.00
56_A	60_G	0.512	1.00
125_L	128_S	0.508	1.00
75_T	78_I	0.504	1.00
13_F	17_F	0.504	1.00
18_N	92_Y	0.502	1.00
43_R	51_A	0.501	1.00
33_L	37_V	0.501	1.00
29_L	33_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zcdA	1	0.5462	14.4	0.879	Contact Map
2b2hA	3	0.8462	3.8	0.907	Contact Map
3orgA	2	0.9077	3.6	0.909	Contact Map
3hd6A	3	0.7231	2.3	0.917	Contact Map
3nd0A	2	0.9154	1.9	0.921	Contact Map
1ciiA	1	0.3769	1.8	0.922	Contact Map
4o9uB	2	0.9538	1.8	0.922	Contact Map
2k3cA	1	0.2385	1.6	0.925	Contact Map
3b9wA	3	0.9077	1.4	0.927	Contact Map
4o93B	1	0.9538	1.3	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.