eIF3_p135 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

eIF3_p135 - Translation initiation factor eIF3 subunit 135

PFAM:	PF12807	Sequences: QLSPMDGQTLTELLHKRGINMRYLGKVAELAAKKPASERLPHLQSLCIQEMIARAAKHILRAYLRSVPAPFLAAAIAHFLNCLLGSSLNPKPKAEIDESLKKLYKKKKKEADFSFEKLTPESLWKEIEEEVKKRYRYELPEDWIDQSLRKLQLLRELCLKVGIQLVARDYDF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	172 (165)
Sequences:	715 (519)
Seq/√Len:	40.4
META:	0.278

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_M	131_V	7.956	1.00
11_T	21_M	4.683	1.00
78_H	82_C	4.251	1.00
55_A	131_V	3.947	1.00
80_L	154_L	3.448	1.00
132_K	138_E	3.074	1.00
56_A	79_F	3.051	1.00
14_L	21_M	2.849	1.00
53_A	153_L	2.516	1.00
130_E	134_R	2.501	1.00
28_A	137_Y	2.257	1.00
20_N	23_Y	2.050	0.99
15_H	18_G	2.023	0.99
21_M	135_Y	1.957	0.99
110_E	113_F	1.823	0.98
24_L	119_T	1.820	0.98
60_L	157_L	1.798	0.98
59_I	127_I	1.722	0.97
10_L	19_I	1.699	0.97
76_I	158_C	1.685	0.97
51_M	55_A	1.659	0.96
60_L	79_F	1.637	0.96
4_P	46_L	1.624	0.96
7_G	10_L	1.612	0.96
27_V	44_Q	1.574	0.95
83_L	123_L	1.566	0.95
148_L	169_D	1.520	0.94
49_Q	149_R	1.475	0.93
28_A	51_M	1.475	0.93
84_L	154_L	1.464	0.93
19_I	23_Y	1.449	0.92
11_T	50_E	1.446	0.92
149_R	152_Q	1.420	0.92
18_G	22_R	1.405	0.91
56_A	60_L	1.393	0.91
105_K	110_E	1.385	0.91
156_E	159_L	1.378	0.90
50_E	54_R	1.377	0.90
21_M	24_L	1.356	0.90
7_G	58_H	1.332	0.89
13_L	19_I	1.323	0.89
60_L	139_L	1.297	0.88
17_R	40_L	1.294	0.87
75_A	82_C	1.280	0.87
58_H	134_R	1.279	0.87
157_L	165_L	1.250	0.86
84_L	157_L	1.243	0.85
142_D	145_D	1.231	0.85
28_A	131_V	1.226	0.84
14_L	140_P	1.213	0.84
100_L	104_Y	1.211	0.84
104_Y	135_Y	1.185	0.82
82_C	119_T	1.176	0.82
7_G	50_E	1.176	0.82
156_E	160_K	1.154	0.81
78_H	120_P	1.134	0.79
40_L	44_Q	1.133	0.79
85_G	161_V	1.131	0.79
40_L	43_L	1.127	0.79
78_H	115_F	1.119	0.78
80_L	165_L	1.096	0.77
4_P	10_L	1.094	0.77
55_A	135_Y	1.086	0.76
26_K	163_I	1.085	0.76
5_M	14_L	1.078	0.76
152_Q	167_A	1.078	0.76
11_T	160_K	1.074	0.76
32_A	135_Y	1.067	0.75
41_P	45_S	1.061	0.75
58_H	130_E	1.050	0.74
27_V	63_Y	1.034	0.73
2_L	13_L	1.033	0.73
62_A	66_S	1.031	0.72
68_P	71_F	1.021	0.72
4_P	162_G	1.017	0.71
10_L	46_L	1.010	0.71
129_E	141_E	1.008	0.71
59_I	126_E	1.004	0.70
80_L	157_L	1.002	0.70
7_G	160_K	1.001	0.70
105_K	135_Y	1.001	0.70
15_H	20_N	0.994	0.70
41_P	52_I	0.986	0.69
27_V	147_S	0.967	0.68
89_N	92_P	0.959	0.67
100_L	163_I	0.954	0.66
15_H	22_R	0.954	0.66
158_C	163_I	0.950	0.66
52_I	144_I	0.949	0.66
43_L	128_E	0.948	0.66
53_A	83_L	0.941	0.65
19_I	122_S	0.939	0.65
46_L	155_R	0.931	0.65
154_L	165_L	0.919	0.64
75_A	78_H	0.917	0.63
62_A	126_E	0.897	0.62
53_A	160_K	0.890	0.61
68_P	111_A	0.887	0.61
82_C	115_F	0.877	0.60
60_L	161_V	0.877	0.60
131_V	136_R	0.874	0.60
158_C	161_V	0.871	0.59
10_L	160_K	0.866	0.59
26_K	29_E	0.849	0.57
9_T	154_L	0.838	0.56
135_Y	139_L	0.838	0.56
77_A	96_I	0.838	0.56
2_L	42_H	0.836	0.56
55_A	58_H	0.816	0.54
116_E	135_Y	0.806	0.53
74_A	89_N	0.805	0.53
69_A	135_Y	0.803	0.53
52_I	76_I	0.803	0.53
123_L	127_I	0.802	0.53
14_L	27_V	0.786	0.52
129_E	168_R	0.783	0.51
54_R	57_K	0.782	0.51
5_M	9_T	0.781	0.51
62_A	128_E	0.774	0.51
3_S	39_R	0.774	0.51
125_K	128_E	0.773	0.50
63_Y	79_F	0.770	0.50
86_S	112_D	0.760	0.49
7_G	130_E	0.760	0.49
26_K	30_L	0.759	0.49
156_E	164_Q	0.759	0.49
119_T	164_Q	0.758	0.49
149_R	167_A	0.751	0.48
21_M	154_L	0.751	0.48
88_L	148_L	0.748	0.48
7_G	14_L	0.745	0.48
46_L	51_M	0.743	0.48
141_E	148_L	0.741	0.47
131_V	148_L	0.739	0.47
23_Y	78_H	0.738	0.47
18_G	25_G	0.736	0.47
47_C	159_L	0.736	0.47
115_F	134_R	0.735	0.47
68_P	115_F	0.728	0.46
31_A	35_P	0.726	0.46
22_R	82_C	0.726	0.46
3_S	30_L	0.724	0.46
153_L	166_V	0.722	0.46
65_R	145_D	0.721	0.46
153_L	161_V	0.719	0.45
21_M	117_K	0.718	0.45
145_D	163_I	0.717	0.45
154_L	172_F	0.717	0.45
9_T	13_L	0.717	0.45
22_R	25_G	0.716	0.45
52_I	170_Y	0.715	0.45
50_E	160_K	0.714	0.45
166_V	170_Y	0.711	0.45
78_H	119_T	0.707	0.44
100_L	103_L	0.706	0.44
96_I	135_Y	0.706	0.44
65_R	115_F	0.699	0.44
101_K	104_Y	0.697	0.43
81_N	85_G	0.693	0.43
85_G	155_R	0.692	0.43
41_P	44_Q	0.687	0.43
12_E	38_E	0.686	0.42
152_Q	163_I	0.683	0.42
74_A	172_F	0.681	0.42
28_A	68_P	0.677	0.42
45_S	66_S	0.676	0.42
127_I	158_C	0.675	0.41
40_L	64_L	0.674	0.41
76_I	81_N	0.673	0.41
27_V	70_P	0.672	0.41
9_T	156_E	0.670	0.41
62_A	129_E	0.669	0.41
43_L	132_K	0.664	0.40
9_T	76_I	0.660	0.40
80_L	163_I	0.658	0.40
39_R	61_R	0.658	0.40
51_M	154_L	0.654	0.40
104_Y	110_E	0.653	0.40
82_C	164_Q	0.648	0.39
119_T	123_L	0.645	0.39
73_A	124_W	0.641	0.38
39_R	43_L	0.639	0.38
71_F	113_F	0.635	0.38
7_G	89_N	0.633	0.38
11_T	171_D	0.631	0.38
5_M	17_R	0.631	0.38
105_K	169_D	0.623	0.37
78_H	83_L	0.623	0.37
22_R	79_F	0.621	0.37
45_S	150_K	0.619	0.37
28_A	47_C	0.618	0.36
61_R	158_C	0.613	0.36
88_L	168_R	0.612	0.36
15_H	54_R	0.612	0.36
46_L	98_E	0.609	0.36
81_N	118_L	0.604	0.35
62_A	98_E	0.598	0.35
53_A	157_L	0.596	0.35
138_E	170_Y	0.594	0.34
59_I	168_R	0.594	0.34
20_N	25_G	0.594	0.34
114_S	142_D	0.591	0.34
24_L	55_A	0.590	0.34
93_K	158_C	0.590	0.34
136_R	139_L	0.590	0.34
59_I	123_L	0.587	0.34
7_G	85_G	0.587	0.34
2_L	46_L	0.581	0.33
30_L	158_C	0.579	0.33
117_K	140_P	0.578	0.33
127_I	131_V	0.577	0.33
125_K	129_E	0.577	0.33
80_L	158_C	0.576	0.33
61_R	135_Y	0.566	0.32
5_M	75_A	0.564	0.32
8_Q	12_E	0.563	0.32
14_L	127_I	0.562	0.32
129_E	133_K	0.562	0.32
91_K	111_A	0.561	0.32
124_W	143_W	0.561	0.32
63_Y	76_I	0.558	0.32
118_L	123_L	0.554	0.31
7_G	11_T	0.553	0.31
143_W	165_L	0.547	0.31
71_F	96_I	0.546	0.31
41_P	130_E	0.544	0.30
7_G	17_R	0.537	0.30
115_F	167_A	0.536	0.30
83_L	134_R	0.535	0.30
19_I	22_R	0.532	0.29
28_A	48_I	0.530	0.29
155_R	158_C	0.530	0.29
9_T	135_Y	0.527	0.29
3_S	60_L	0.526	0.29
20_N	54_R	0.526	0.29
7_G	73_A	0.525	0.29
88_L	133_K	0.523	0.29
37_S	124_W	0.522	0.29
130_E	133_K	0.518	0.28
131_V	152_Q	0.516	0.28
33_K	86_S	0.513	0.28
19_I	137_Y	0.512	0.28
82_C	120_P	0.511	0.28
87_S	150_K	0.504	0.27
3_S	61_R	0.503	0.27
144_I	170_Y	0.503	0.27
46_L	140_P	0.500	0.27
55_A	78_H	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q6rA	2	0.4535	14.4	0.944	Contact Map
3gxvA	4	0.3779	13.3	0.945	Contact Map
3j7yh	1	0.3314	13.3	0.945	Contact Map
3epzA	1	0.7791	12.6	0.945	Contact Map
3ejbA	1	0.3198	9.5	0.948	Contact Map
2r5uA	5	0.4884	9.2	0.948	Contact Map
4a6rA	2	0.3779	8.8	0.949	Contact Map
4a0gA	2	0.3198	8	0.95	Contact Map
1klpA	1	0.3314	7.9	0.95	Contact Map
4w8iA	2	0.3081	7.4	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.