RsgI_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RsgI_N - Anti-sigma factor N-terminus

PFAM:	PF12791	Sequences: MEIKKKYAIVLTPDGEFLKIKRKKGMEVGQEIEFPEKDIIKKKRKLLYAAAAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	53 (50)
Sequences:	859 (780)
Seq/√Len:	110.3
META:	0.725

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_Y	19_K	3.613	1.00
8_A	22_R	2.919	1.00
11_L	17_F	2.602	1.00
8_A	26_M	2.558	1.00
11_L	15_G	2.149	1.00
18_L	34_F	2.120	1.00
3_I	8_A	1.619	1.00
22_R	26_M	1.542	1.00
13_P	31_E	1.497	1.00
12_T	34_F	1.410	1.00
9_I	17_F	1.390	1.00
4_K	9_I	1.373	1.00
26_M	30_Q	1.350	1.00
12_T	16_E	1.322	1.00
27_E	30_Q	1.303	0.99
1_M	17_F	1.236	0.99
17_F	30_Q	1.211	0.99
10_V	34_F	1.184	0.99
32_I	35_P	1.118	0.98
8_A	20_I	1.079	0.98
34_F	40_I	1.066	0.98
1_M	11_L	1.050	0.97
4_K	19_K	1.044	0.97
1_M	15_G	1.026	0.97
19_K	23_K	1.021	0.97
2_E	9_I	1.019	0.97
10_V	20_I	0.999	0.97
27_E	31_E	0.943	0.95
44_R	47_L	0.915	0.94
39_I	43_K	0.894	0.94
38_D	41_K	0.872	0.93
19_K	48_Y	0.837	0.91
2_E	17_F	0.820	0.90
14_D	49_A	0.812	0.90
10_V	35_P	0.808	0.90
30_Q	35_P	0.806	0.90
32_I	49_A	0.786	0.88
39_I	46_L	0.782	0.88
8_A	11_L	0.782	0.88
3_I	32_I	0.769	0.87
47_L	50_A	0.766	0.87
15_G	31_E	0.759	0.87
23_K	38_D	0.750	0.86
36_E	40_I	0.748	0.86
34_F	38_D	0.747	0.86
37_K	42_K	0.739	0.85
6_K	41_K	0.735	0.85
46_L	50_A	0.734	0.85
9_I	13_P	0.729	0.84
5_K	39_I	0.719	0.84
15_G	29_G	0.687	0.81
33_E	39_I	0.669	0.79
20_I	29_G	0.658	0.78
11_L	28_V	0.658	0.78
7_Y	10_V	0.634	0.75
23_K	26_M	0.619	0.74
14_D	34_F	0.618	0.73
2_E	11_L	0.617	0.73
42_K	45_K	0.616	0.73
24_K	27_E	0.615	0.73
39_I	44_R	0.615	0.73
17_F	27_E	0.608	0.72
36_E	44_R	0.607	0.72
44_R	49_A	0.607	0.72
19_K	31_E	0.589	0.70
15_G	30_Q	0.574	0.68
26_M	32_I	0.574	0.68
18_L	33_E	0.574	0.68
21_K	40_I	0.565	0.67
11_L	30_Q	0.560	0.66
7_Y	22_R	0.555	0.65
13_P	37_K	0.550	0.65
10_V	49_A	0.529	0.62
17_F	33_E	0.528	0.61
7_Y	48_Y	0.500	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bbjA	1	0.9811	38.1	0.769	Contact Map
4umwA	1	0.9623	21.5	0.796	Contact Map
1vw4N	1	1	20.6	0.798	Contact Map
3j08A	2	0.9623	18.5	0.802	Contact Map
3j09A	2	0.9623	18.4	0.802	Contact Map
1whiA	2	0.8113	15.5	0.808	Contact Map
4rb6O	1	0.8113	15.1	0.809	Contact Map
1t9hA	1	1	14.7	0.811	Contact Map
1khiA	1	0.9057	13.9	0.813	Contact Map
3bboT	1	0.9057	13.4	0.814	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.