Maff2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Maff2 - Maff2 family

PFAM:	PF12750	Sequences: MEFFTSAIDVLQTLVIALGAGLGVWGVINLLEGYGNDNPGAKSQGIKQLMAGGGVALIGTTLVPLLSGLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	70 (70)
Sequences:	508 (190)
Seq/√Len:	22.7
META:	0.872

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_N	40_G	3.418	1.00
65_L	68_G	2.443	0.98
44_Q	48_Q	2.278	0.97
2_E	5_T	2.161	0.96
34_Y	37_D	2.118	0.95
49_L	53_G	2.041	0.94
59_G	63_V	1.965	0.93
24_V	63_V	1.946	0.92
23_G	65_L	1.873	0.91
17_A	53_G	1.851	0.90
1_M	4_F	1.841	0.90
37_D	44_Q	1.768	0.88
16_I	60_T	1.755	0.88
16_I	59_G	1.730	0.87
6_S	9_D	1.706	0.86
21_G	50_M	1.668	0.85
4_F	13_T	1.571	0.81
30_L	39_P	1.567	0.81
33_G	45_G	1.471	0.77
10_V	18_L	1.454	0.76
2_E	9_D	1.414	0.74
40_G	43_S	1.404	0.73
31_L	58_I	1.402	0.73
67_S	70_F	1.370	0.71
42_K	47_K	1.314	0.68
7_A	17_A	1.248	0.64
43_S	54_G	1.240	0.63
17_A	21_G	1.239	0.63
33_G	36_N	1.181	0.59
34_Y	47_K	1.148	0.57
45_G	48_Q	1.083	0.53
6_S	12_Q	1.072	0.52
16_I	69_L	1.072	0.52
55_V	61_T	1.068	0.52
15_V	46_I	1.040	0.50
14_L	17_A	1.017	0.48
8_I	13_T	1.015	0.48
6_S	13_T	1.006	0.47
29_N	48_Q	0.988	0.46
39_P	42_K	0.979	0.46
27_V	56_A	0.896	0.40
37_D	47_K	0.889	0.40
62_L	67_S	0.866	0.38
33_G	38_N	0.859	0.38
16_I	56_A	0.851	0.37
10_V	62_L	0.850	0.37
29_N	38_N	0.847	0.37
32_E	36_N	0.843	0.37
18_L	21_G	0.839	0.36
44_Q	47_K	0.828	0.36
17_A	55_V	0.828	0.36
44_Q	51_A	0.825	0.35
27_V	53_G	0.819	0.35
56_A	59_G	0.797	0.34
44_Q	66_L	0.795	0.34
60_T	63_V	0.751	0.31
34_Y	43_S	0.745	0.31
22_L	57_L	0.736	0.30
47_K	54_G	0.729	0.30
37_D	66_L	0.718	0.29
15_V	28_I	0.715	0.29
61_T	65_L	0.707	0.28
42_K	51_A	0.696	0.28
5_T	68_G	0.694	0.28
33_G	66_L	0.692	0.28
24_V	61_T	0.689	0.27
24_V	56_A	0.682	0.27
34_Y	38_N	0.672	0.26
51_A	56_A	0.668	0.26
24_V	60_T	0.666	0.26
2_E	16_I	0.663	0.26
12_Q	59_G	0.658	0.26
33_G	52_G	0.650	0.25
34_Y	54_G	0.636	0.25
31_L	60_T	0.629	0.24
4_F	55_V	0.626	0.24
27_V	50_M	0.619	0.24
24_V	49_L	0.613	0.23
25_W	35_G	0.611	0.23
29_N	34_Y	0.610	0.23
2_E	23_G	0.603	0.23
27_V	70_F	0.600	0.23
36_N	44_Q	0.592	0.22
15_V	59_G	0.578	0.22
57_L	61_T	0.571	0.21
17_A	50_M	0.570	0.21
9_D	13_T	0.563	0.21
30_L	35_G	0.558	0.21
4_F	12_Q	0.556	0.21
6_S	10_V	0.552	0.20
22_L	25_W	0.551	0.20
30_L	41_A	0.551	0.20
9_D	67_S	0.541	0.20
30_L	47_K	0.534	0.20
43_S	49_L	0.532	0.20
15_V	49_L	0.526	0.19
37_D	48_Q	0.521	0.19
12_Q	60_T	0.517	0.19
35_G	48_Q	0.516	0.19
57_L	60_T	0.511	0.19
47_K	51_A	0.510	0.19
61_T	69_L	0.507	0.19
7_A	49_L	0.504	0.18
31_L	54_G	0.502	0.18
50_M	54_G	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bs2C	2	0.6571	4.6	0.911	Contact Map
4humA	1	0.9857	4.5	0.911	Contact Map
3j8eG	3	0.7429	3.6	0.915	Contact Map
4k0jA	3	0.9714	3	0.918	Contact Map
3mktA	1	0.9857	3	0.918	Contact Map
4mt1A	3	0.9714	2.8	0.92	Contact Map
1ckkB	1	0.1571	2.4	0.922	Contact Map
1iq5B	1	0.1143	2.4	0.923	Contact Map
3w4tA	1	0.9857	2.3	0.924	Contact Map
3ne5A	3	0.9714	2.1	0.925	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.