DUF3795 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3795 - Protein of unknown function (DUF3795)

PFAM:	PF12675	Sequences: MIAPCGLYCGLCPAYLREKTAEKWSKLFGALITPEDINCDGCRSGDGRKFGHCRKDCEIRKCAKEKGVEFCAECDEFPCEKLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (82)
Sequences:	13175 (8213)
Seq/√Len:	907.0
META:	0.972

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_Y	11_L	2.686	1.00
4_P	63_A	2.604	1.00
4_P	43_R	2.348	1.00
33_T	36_D	2.320	1.00
70_F	73_E	2.259	1.00
58_E	81_K	2.203	1.00
22_E	26_K	2.028	1.00
66_K	76_E	2.006	1.00
69_E	73_E	2.003	1.00
40_D	48_R	1.901	1.00
18_E	22_E	1.865	1.00
63_A	68_V	1.712	1.00
24_W	27_L	1.702	1.00
16_L	19_K	1.667	1.00
20_T	24_W	1.568	1.00
19_K	22_E	1.566	1.00
28_F	31_L	1.537	1.00
25_S	31_L	1.437	1.00
68_V	73_E	1.422	1.00
23_K	27_L	1.417	1.00
2_I	8_Y	1.415	1.00
19_K	23_K	1.383	1.00
22_E	25_S	1.338	1.00
43_R	69_E	1.324	1.00
25_S	29_G	1.323	1.00
23_K	26_K	1.321	1.00
26_K	29_G	1.310	1.00
17_R	21_A	1.308	1.00
45_G	49_K	1.244	1.00
16_L	20_T	1.243	1.00
17_R	38_N	1.216	1.00
51_G	55_K	1.177	1.00
51_G	54_R	1.171	1.00
40_D	44_S	1.149	1.00
25_S	30_A	1.132	1.00
32_I	36_D	1.117	1.00
53_C	56_D	1.115	1.00
24_W	28_F	1.111	1.00
3_A	7_L	1.107	1.00
40_D	47_G	1.106	1.00
58_E	61_K	1.091	1.00
60_R	64_K	1.076	1.00
2_I	10_G	1.067	1.00
39_C	42_C	1.062	1.00
4_P	64_K	1.037	1.00
27_L	30_A	1.027	1.00
32_I	37_I	1.011	1.00
77_F	82_L	1.005	1.00
17_R	20_T	1.002	1.00
2_I	70_F	0.996	1.00
21_A	24_W	0.996	1.00
43_R	70_F	0.993	1.00
20_T	28_F	0.982	1.00
50_F	53_C	0.974	1.00
21_A	25_S	0.968	1.00
24_W	30_A	0.950	1.00
52_H	55_K	0.947	1.00
16_L	21_A	0.946	1.00
18_E	21_A	0.937	1.00
68_V	77_F	0.928	1.00
27_L	31_L	0.914	1.00
61_K	65_E	0.897	1.00
25_S	28_F	0.884	1.00
20_T	23_K	0.856	1.00
34_P	37_I	0.826	1.00
18_E	23_K	0.810	1.00
24_W	29_G	0.802	1.00
22_E	28_F	0.790	1.00
46_D	49_K	0.783	1.00
40_D	46_D	0.752	1.00
36_D	51_G	0.740	1.00
40_D	49_K	0.738	1.00
4_P	60_R	0.734	1.00
26_K	30_A	0.734	1.00
70_F	77_F	0.733	1.00
56_D	61_K	0.709	1.00
17_R	24_W	0.697	1.00
20_T	27_L	0.692	1.00
22_E	30_A	0.691	1.00
50_F	54_R	0.688	1.00
45_G	48_R	0.672	1.00
13_P	23_K	0.671	1.00
14_A	37_I	0.665	1.00
16_L	23_K	0.664	1.00
13_P	20_T	0.662	1.00
19_K	24_W	0.640	1.00
23_K	28_F	0.639	1.00
49_K	60_R	0.626	1.00
44_S	53_C	0.625	1.00
26_K	31_L	0.610	1.00
66_K	75_D	0.606	1.00
32_I	35_E	0.605	1.00
11_L	14_A	0.603	1.00
68_V	75_D	0.603	1.00
78_P	81_K	0.603	1.00
75_D	80_E	0.603	1.00
38_N	50_F	0.598	1.00
47_G	60_R	0.594	1.00
7_L	59_I	0.577	1.00
22_E	31_L	0.571	1.00
16_L	31_L	0.565	1.00
33_T	38_N	0.561	1.00
49_K	53_C	0.561	1.00
49_K	54_R	0.557	1.00
78_P	83_K	0.549	1.00
10_G	15_Y	0.549	1.00
3_A	14_A	0.543	1.00
46_D	50_F	0.537	1.00
70_F	82_L	0.536	1.00
33_T	37_I	0.535	1.00
80_E	83_K	0.533	1.00
21_A	26_K	0.532	1.00
17_R	23_K	0.529	1.00
7_L	11_L	0.529	1.00
28_F	34_P	0.528	1.00
14_A	24_W	0.522	1.00
14_A	53_C	0.522	1.00
52_H	56_D	0.520	1.00
68_V	72_A	0.517	1.00
71_C	74_C	0.509	1.00
63_A	67_G	0.503	1.00
72_A	77_F	0.502	1.00
11_L	33_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ljoA	1	0.6386	3.3	0.897	Contact Map
2mcrA	1	0.1446	3.1	0.898	Contact Map
2fmaA	1	0.241	2.9	0.9	Contact Map
2b9dA	2	0.5542	2.1	0.907	Contact Map
2ewlA	1	0.5422	2	0.907	Contact Map
4kblA	2	0.8554	2	0.908	Contact Map
3t6pA	1	0.3976	1.7	0.911	Contact Map
4b7jA	3	0.3373	1.6	0.913	Contact Map
1ti6B	2	0.5904	1.5	0.914	Contact Map
2mvwA	2	0.4217	1.4	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.