Zn_ribbon_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Zn_ribbon_2 - Putative zinc ribbon domain

PFAM:	PF12674	Sequences: FCQSCGMPLKDDEDGGTNADGSKSEDYCSYCYQDGKFTSPDITMEEMIEFCVPKMKEMGKNMTEEEARAMMTRFLPKLKRWK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (81)
Sequences:	6460 (4139)
Seq/√Len:	459.9
META:	0.919

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_D	79_K	4.780	1.00
11_D	14_D	2.655	1.00
39_S	42_I	2.500	1.00
39_S	50_F	2.397	1.00
33_Q	38_T	2.197	1.00
54_K	57_E	2.143	1.00
18_N	24_S	2.100	1.00
7_M	30_Y	1.967	1.00
18_N	32_Y	1.923	1.00
63_T	66_E	1.907	1.00
42_I	50_F	1.808	1.00
64_E	68_R	1.722	1.00
44_M	75_L	1.685	1.00
18_N	22_S	1.668	1.00
9_L	15_G	1.663	1.00
10_K	14_D	1.658	1.00
43_T	46_E	1.608	1.00
14_D	29_S	1.600	1.00
12_D	15_G	1.408	1.00
44_M	48_I	1.406	1.00
46_E	49_E	1.347	1.00
19_A	36_K	1.329	1.00
50_F	54_K	1.306	1.00
52_V	56_K	1.306	1.00
70_M	74_F	1.296	1.00
3_Q	26_D	1.257	1.00
29_S	33_Q	1.235	1.00
65_E	69_A	1.229	1.00
45_E	48_I	1.221	1.00
52_V	68_R	1.215	1.00
4_S	80_R	1.191	1.00
69_A	73_R	1.175	1.00
12_D	23_K	1.174	1.00
42_I	46_E	1.150	1.00
68_R	72_T	1.118	1.00
66_E	69_A	1.114	1.00
70_M	73_R	1.102	1.00
49_E	68_R	1.097	1.00
20_D	24_S	1.077	1.00
47_M	51_C	1.065	1.00
38_T	43_T	1.052	1.00
51_C	71_M	1.047	1.00
15_G	25_E	1.039	1.00
59_G	62_M	1.034	1.00
49_E	53_P	1.032	1.00
74_F	77_K	1.018	1.00
71_M	75_L	0.980	1.00
77_K	82_K	0.942	1.00
69_A	72_T	0.925	1.00
53_P	64_E	0.916	1.00
56_K	64_E	0.899	1.00
2_C	5_C	0.891	1.00
44_M	72_T	0.886	1.00
55_M	58_M	0.882	1.00
44_M	76_P	0.859	1.00
28_C	31_C	0.850	1.00
53_P	56_K	0.833	1.00
54_K	58_M	0.830	1.00
55_M	59_G	0.799	1.00
27_Y	37_F	0.795	1.00
51_C	54_K	0.794	1.00
16_G	19_A	0.788	1.00
48_I	72_T	0.785	1.00
17_T	33_Q	0.779	1.00
15_G	29_S	0.766	1.00
17_T	23_K	0.761	1.00
11_D	15_G	0.757	1.00
42_I	47_M	0.748	1.00
45_E	49_E	0.733	1.00
13_E	23_K	0.732	1.00
44_M	71_M	0.727	1.00
52_V	72_T	0.723	1.00
64_E	67_A	0.709	1.00
73_R	77_K	0.687	1.00
40_P	47_M	0.668	1.00
36_K	41_D	0.658	1.00
4_S	37_F	0.653	1.00
50_F	53_P	0.652	1.00
56_K	60_K	0.652	1.00
66_E	70_M	0.650	1.00
36_K	40_P	0.649	1.00
51_C	75_L	0.642	1.00
51_C	55_M	0.637	0.99
48_I	76_P	0.630	0.99
62_M	70_M	0.628	0.99
60_K	67_A	0.623	0.99
37_F	78_L	0.622	0.99
40_P	43_T	0.621	0.99
11_D	29_S	0.613	0.99
79_K	82_K	0.613	0.99
48_I	52_V	0.610	0.99
56_K	67_A	0.609	0.99
45_E	72_T	0.607	0.99
1_F	74_F	0.605	0.99
47_M	55_M	0.603	0.99
16_G	24_S	0.603	0.99
13_E	29_S	0.597	0.99
38_T	42_I	0.597	0.99
6_G	74_F	0.597	0.99
37_F	80_R	0.593	0.99
48_I	68_R	0.590	0.99
16_G	35_G	0.588	0.99
68_R	71_M	0.587	0.99
15_G	23_K	0.581	0.99
52_V	64_E	0.572	0.99
44_M	47_M	0.570	0.99
47_M	50_F	0.569	0.99
55_M	71_M	0.568	0.99
40_P	76_P	0.562	0.99
53_P	58_M	0.542	0.98
62_M	67_A	0.534	0.98
67_A	74_F	0.531	0.98
42_I	54_K	0.529	0.98
56_K	65_E	0.529	0.98
56_K	59_G	0.525	0.98
48_I	75_L	0.523	0.98
71_M	74_F	0.520	0.98
52_V	69_A	0.515	0.98
67_A	71_M	0.513	0.98
11_D	23_K	0.512	0.98
3_Q	32_Y	0.506	0.97
16_G	23_K	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qqcA	1	0.8659	55.9	0.857	Contact Map
2pv0B	1	0.9512	48	0.864	Contact Map
2jtnA	1	0.4146	47.9	0.864	Contact Map
2co8A	1	0.4756	42.1	0.869	Contact Map
4u7tA	2	0.8902	40.3	0.87	Contact Map
2lzuA	1	0.4756	37.6	0.872	Contact Map
2fc7A	1	0.7195	34.5	0.874	Contact Map
4glxA	1	0.9024	32.7	0.876	Contact Map
2xqnT	1	0.378	30.1	0.878	Contact Map
3h2yA	1	0.4756	29.7	0.879	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.