DUF3792 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3792 - Protein of unknown function (DUF3792)

PFAM:	PF12670	Sequences: NIKAILKGLLIALIITLILLLILALLLYFTSLSESVLSIVIIIITILSIFIGGFIAGKKAGKKGWLHGLLVGLLYFLILLLISLLFYDGFFIFSLSLLIKLLLCLLAGALGGILG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	115 (113)
Sequences:	3548 (3023)
Seq/√Len:	284.3
META:	0.802

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_L	44_I	3.442	1.00
12_A	52_G	3.254	1.00
11_I	55_I	2.458	1.00
52_G	71_V	2.457	1.00
69_L	105_L	2.436	1.00
39_I	43_I	2.404	1.00
65_W	113_I	2.293	1.00
46_I	107_A	2.225	1.00
56_A	71_V	2.176	1.00
64_G	115_G	2.099	1.00
16_T	75_Y	2.093	1.00
60_A	67_H	2.006	1.00
76_F	104_C	1.988	1.00
76_F	101_L	1.980	1.00
64_G	68_G	1.979	1.00
53_G	57_G	1.977	1.00
107_A	111_G	1.883	1.00
64_G	112_G	1.822	1.00
8_G	56_A	1.817	1.00
9_L	74_L	1.712	1.00
49_I	53_G	1.584	1.00
36_V	39_I	1.559	1.00
16_T	48_S	1.553	1.00
8_G	12_A	1.547	1.00
26_L	32_L	1.528	1.00
68_G	108_G	1.512	1.00
3_K	7_K	1.498	1.00
43_I	47_L	1.484	1.00
9_L	13_L	1.468	1.00
23_L	40_V	1.465	1.00
104_C	108_G	1.465	1.00
99_I	103_L	1.459	1.00
25_L	29_F	1.443	1.00
26_L	30_T	1.436	1.00
69_L	109_A	1.426	1.00
108_G	112_G	1.418	1.00
46_I	50_F	1.349	1.00
11_I	51_I	1.299	1.00
19_L	23_L	1.245	1.00
55_I	59_K	1.221	1.00
53_G	71_V	1.199	1.00
8_G	52_G	1.194	1.00
49_I	104_C	1.175	1.00
102_L	106_L	1.159	1.00
111_G	115_G	1.129	1.00
5_I	71_V	1.126	1.00
12_A	48_S	1.106	1.00
45_T	75_Y	1.105	1.00
54_F	114_L	1.100	1.00
45_T	104_C	1.083	1.00
23_L	37_L	1.081	1.00
15_I	48_S	1.081	1.00
49_I	108_G	1.074	1.00
46_I	103_L	1.063	1.00
64_G	109_A	1.054	1.00
98_L	102_L	1.048	1.00
57_G	60_A	1.038	1.00
9_L	71_V	1.032	1.00
99_I	102_L	1.028	1.00
72_G	104_C	1.006	1.00
103_L	107_A	0.989	1.00
53_G	111_G	0.985	1.00
41_I	45_T	0.973	1.00
65_W	109_A	0.966	1.00
26_L	68_G	0.963	1.00
73_L	105_L	0.963	1.00
52_G	56_A	0.933	1.00
51_I	55_I	0.919	1.00
30_T	34_E	0.912	1.00
63_K	67_H	0.911	1.00
50_F	54_F	0.889	1.00
37_L	41_I	0.867	1.00
93_F	97_L	0.864	1.00
7_K	59_K	0.854	1.00
84_L	87_Y	0.838	1.00
42_I	100_K	0.823	1.00
8_G	55_I	0.816	1.00
12_A	16_T	0.815	1.00
68_G	72_G	0.812	0.99
57_G	111_G	0.807	0.99
100_K	115_G	0.801	0.99
3_K	6_L	0.800	0.99
54_F	58_K	0.789	0.99
95_L	98_L	0.781	0.99
65_W	69_L	0.778	0.99
20_L	41_I	0.777	0.99
80_L	84_L	0.776	0.99
94_S	97_L	0.770	0.99
25_L	115_G	0.769	0.99
49_I	75_Y	0.762	0.99
56_A	67_H	0.762	0.99
27_L	34_E	0.758	0.99
48_S	52_G	0.746	0.99
13_L	17_L	0.743	0.99
4_A	60_A	0.739	0.99
16_T	42_I	0.735	0.99
5_I	9_L	0.734	0.99
72_G	108_G	0.730	0.99
67_H	70_L	0.719	0.99
8_G	48_S	0.716	0.99
8_G	71_V	0.715	0.99
105_L	109_A	0.714	0.99
41_I	83_S	0.702	0.99
50_F	97_L	0.690	0.98
20_L	52_G	0.688	0.98
44_I	48_S	0.688	0.98
4_A	8_G	0.661	0.98
15_I	102_L	0.656	0.98
24_A	45_T	0.654	0.98
101_L	105_L	0.652	0.98
39_I	84_L	0.651	0.98
61_G	64_G	0.648	0.98
110_L	114_L	0.646	0.97
66_L	77_L	0.643	0.97
75_Y	79_L	0.643	0.97
57_G	68_G	0.638	0.97
73_L	77_L	0.637	0.97
15_I	19_L	0.630	0.97
76_F	100_K	0.626	0.97
45_T	76_F	0.622	0.97
40_V	54_F	0.621	0.97
82_I	86_F	0.619	0.97
12_A	20_L	0.614	0.97
9_L	17_L	0.614	0.97
12_A	71_V	0.614	0.97
56_A	60_A	0.612	0.96
65_W	115_G	0.611	0.96
101_L	104_C	0.609	0.96
53_G	59_K	0.609	0.96
97_L	101_L	0.609	0.96
22_I	26_L	0.608	0.96
4_A	56_A	0.608	0.96
30_T	69_L	0.605	0.96
96_S	100_K	0.604	0.96
21_L	24_A	0.603	0.96
41_I	100_K	0.603	0.96
24_A	28_Y	0.602	0.96
15_I	51_I	0.601	0.96
23_L	27_L	0.597	0.96
53_G	67_H	0.597	0.96
5_I	8_G	0.591	0.96
81_L	85_L	0.590	0.96
55_I	80_L	0.573	0.95
37_L	54_F	0.571	0.95
88_D	91_F	0.570	0.95
79_L	83_S	0.568	0.95
20_L	66_L	0.568	0.95
65_W	107_A	0.559	0.94
6_L	18_I	0.559	0.94
41_I	44_I	0.558	0.94
9_L	67_H	0.550	0.94
75_Y	104_C	0.546	0.94
5_I	67_H	0.543	0.93
41_I	67_H	0.543	0.93
4_A	59_K	0.536	0.93
45_T	72_G	0.534	0.93
58_K	61_G	0.533	0.93
42_I	76_F	0.524	0.92
50_F	114_L	0.523	0.92
36_V	40_V	0.522	0.92
69_L	73_L	0.522	0.92
20_L	24_A	0.521	0.92
72_G	76_F	0.520	0.92
28_Y	31_S	0.518	0.92
27_L	31_S	0.516	0.91
28_Y	103_L	0.514	0.91
33_S	46_I	0.514	0.91
9_L	111_G	0.513	0.91
94_S	114_L	0.510	0.91
14_I	22_I	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ev6A	3	0.5652	39.2	0.806	Contact Map
4i0uA	4	0.5478	33.9	0.812	Contact Map
2cfqA	1	1	7.5	0.861	Contact Map
4q2eA	2	0.9478	6.9	0.864	Contact Map
4pypA	1	0.9739	6.2	0.867	Contact Map
4m5bA	1	0.7043	5.7	0.869	Contact Map
3dh4A	3	0.9217	5.5	0.87	Contact Map
3pjzA	2	0.9565	4.3	0.876	Contact Map
4m64A	1	0.9043	4.3	0.877	Contact Map
3wdoA	1	0.887	4	0.878	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.