TcpE - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TcpE - TcpE family

PFAM:	PF12648	Sequences: SYTRIFRIEKRIYKIGDFRLPFPVPLRQIGYFVAILLLVLLLLRLPGLINGVLPFLLLYVVIPGALAWLLTRPKPDGKRPHRFLKSQLRYLFRPKLWYRGIYQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	103 (97)
Sequences:	833 (611)
Seq/√Len:	62.1
META:	0.701

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_F	67_A	4.051	1.00
39_V	62_I	3.083	1.00
31_Y	70_L	2.646	1.00
26_L	30_G	2.532	1.00
59_Y	63_P	2.397	1.00
35_I	66_L	2.083	1.00
14_K	17_D	1.970	1.00
1_S	31_Y	1.867	1.00
9_E	13_Y	1.839	1.00
25_P	28_Q	1.810	1.00
6_F	13_Y	1.764	0.99
87_Q	90_Y	1.729	0.99
53_L	61_V	1.704	0.99
67_A	71_T	1.671	0.99
35_I	67_A	1.654	0.99
29_I	64_G	1.592	0.99
82_R	85_K	1.589	0.99
94_P	97_W	1.589	0.99
33_V	37_L	1.574	0.99
83_F	87_Q	1.568	0.99
5_I	13_Y	1.520	0.98
37_L	40_L	1.485	0.98
26_L	70_L	1.470	0.98
13_Y	23_P	1.433	0.98
41_L	62_I	1.404	0.97
28_Q	67_A	1.401	0.97
85_K	91_L	1.360	0.97
9_E	86_S	1.360	0.97
78_K	83_F	1.328	0.96
40_L	88_L	1.326	0.96
10_K	78_K	1.317	0.96
69_L	75_P	1.295	0.96
93_R	97_W	1.232	0.94
56_L	88_L	1.225	0.94
1_S	8_I	1.222	0.94
91_L	95_K	1.215	0.94
60_V	69_L	1.214	0.94
24_V	40_L	1.211	0.94
9_E	46_P	1.210	0.94
32_F	59_Y	1.202	0.94
85_K	89_R	1.149	0.92
33_V	36_L	1.138	0.92
15_I	33_V	1.134	0.92
30_G	82_R	1.128	0.91
2_Y	7_R	1.116	0.91
88_L	92_F	1.095	0.90
78_K	90_Y	1.075	0.89
64_G	68_W	1.072	0.89
32_F	64_G	1.045	0.88
42_L	48_L	1.044	0.88
10_K	86_S	1.024	0.87
3_T	86_S	0.982	0.84
41_L	76_D	0.959	0.83
35_I	89_R	0.953	0.83
4_R	72_R	0.953	0.83
1_S	6_F	0.951	0.82
84_L	96_L	0.934	0.81
28_Q	68_W	0.932	0.81
50_N	53_L	0.915	0.80
69_L	73_P	0.908	0.79
83_F	86_S	0.888	0.78
87_Q	91_L	0.884	0.78
6_F	27_R	0.884	0.78
27_R	46_P	0.883	0.77
11_R	25_P	0.869	0.76
4_R	16_G	0.869	0.76
3_T	68_W	0.868	0.76
46_P	64_G	0.865	0.76
40_L	52_V	0.860	0.76
62_I	73_P	0.838	0.74
70_L	74_K	0.836	0.74
6_F	80_P	0.836	0.74
12_I	26_L	0.832	0.73
65_A	69_L	0.831	0.73
49_I	52_V	0.831	0.73
22_F	25_P	0.799	0.70
23_P	77_G	0.798	0.70
13_Y	20_L	0.795	0.70
30_G	39_V	0.795	0.70
4_R	9_E	0.785	0.69
72_R	75_P	0.782	0.68
15_I	85_K	0.779	0.68
35_I	39_V	0.765	0.67
8_I	11_R	0.761	0.66
31_Y	76_D	0.759	0.66
18_F	23_P	0.741	0.64
43_L	50_N	0.741	0.64
33_V	66_L	0.736	0.64
48_L	60_V	0.720	0.62
40_L	49_I	0.715	0.62
41_L	45_L	0.714	0.61
34_A	42_L	0.712	0.61
44_R	48_L	0.698	0.60
24_V	39_V	0.696	0.59
7_R	21_P	0.694	0.59
50_N	61_V	0.694	0.59
50_N	54_P	0.691	0.59
57_L	81_H	0.690	0.59
24_V	29_I	0.683	0.58
79_R	82_R	0.683	0.58
2_Y	42_L	0.682	0.58
19_R	71_T	0.680	0.58
57_L	84_L	0.680	0.58
31_Y	58_L	0.678	0.57
39_V	76_D	0.673	0.57
23_P	71_T	0.671	0.57
32_F	80_P	0.666	0.56
6_F	86_S	0.663	0.56
7_R	29_I	0.653	0.55
8_I	75_P	0.635	0.53
10_K	16_G	0.633	0.52
29_I	70_L	0.632	0.52
41_L	50_N	0.626	0.52
37_L	41_L	0.624	0.51
34_A	53_L	0.620	0.51
7_R	82_R	0.618	0.51
5_I	8_I	0.616	0.50
26_L	89_R	0.608	0.50
56_L	65_A	0.604	0.49
57_L	77_G	0.591	0.48
18_F	65_A	0.590	0.47
31_Y	67_A	0.589	0.47
52_V	60_V	0.587	0.47
5_I	74_K	0.585	0.47
61_V	64_G	0.576	0.46
89_R	93_R	0.576	0.46
13_Y	71_T	0.571	0.45
40_L	59_Y	0.568	0.45
9_E	27_R	0.558	0.44
49_I	74_K	0.557	0.44
23_P	30_G	0.555	0.43
80_P	84_L	0.554	0.43
31_Y	84_L	0.548	0.43
9_E	74_K	0.545	0.42
35_I	49_I	0.541	0.42
82_R	86_S	0.539	0.42
2_Y	68_W	0.529	0.41
36_L	39_V	0.529	0.41
64_G	74_K	0.522	0.40
92_F	97_W	0.519	0.39
5_I	9_E	0.516	0.39
1_S	28_Q	0.515	0.39
17_D	28_Q	0.513	0.39
1_S	10_K	0.510	0.39
36_L	58_L	0.502	0.38
37_L	92_F	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j01B	1	0.7573	2.4	0.919	Contact Map
4hfiA	3	0.3495	2	0.922	Contact Map
2mbgA	1	0.4951	2	0.923	Contact Map
4w252	1	0.2718	1.8	0.924	Contact Map
4b03D	5	0.5631	1.7	0.926	Contact Map
2ovjA	1	0.3786	1.6	0.927	Contact Map
1rh5B	1	0.233	1.3	0.931	Contact Map
3mp7B	1	0.233	1.2	0.933	Contact Map
1tx4A	1	0.4563	1	0.935	Contact Map
4rb5J	1	0.2913	1	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.