DUF3783 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3783 - Domain of unknown function (DUF3783)

PFAM:	PF12646	Sequences: EMLIFSGFSEEELDALLDALRKAGLPIPLKAVLTPTNENWTLKDLLEELAEEHEAM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	56 (56)
Sequences:	1985 (1505)
Seq/√Len:	201.1
META:	0.826

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_S	33_L	3.549	1.00
41_T	44_D	2.857	1.00
9_S	12_E	2.443	1.00
2_M	42_L	2.391	1.00
29_L	49_L	2.276	1.00
33_L	38_E	2.141	1.00
48_E	51_E	1.803	1.00
44_D	48_E	1.784	1.00
2_M	46_L	1.776	1.00
1_E	27_I	1.590	1.00
28_P	53_H	1.546	1.00
50_A	54_E	1.484	1.00
14_D	17_L	1.462	1.00
40_W	52_E	1.376	1.00
14_D	18_D	1.357	1.00
27_I	30_K	1.229	1.00
35_P	38_E	1.216	1.00
19_A	23_A	1.169	1.00
53_H	56_M	1.156	1.00
11_E	15_A	1.129	1.00
37_N	45_L	1.128	1.00
20_L	26_P	1.123	1.00
20_L	30_K	1.110	1.00
50_A	53_H	1.087	1.00
42_L	46_L	1.061	1.00
17_L	30_K	1.020	1.00
12_E	15_A	1.011	1.00
34_T	52_E	1.003	1.00
4_I	31_A	0.992	1.00
36_T	40_W	0.981	1.00
47_E	54_E	0.974	1.00
51_E	55_A	0.960	0.99
52_E	56_M	0.959	0.99
20_L	25_L	0.934	0.99
31_A	49_L	0.929	0.99
10_E	14_D	0.919	0.99
13_L	17_L	0.906	0.99
47_E	51_E	0.901	0.99
15_A	19_A	0.896	0.99
8_F	12_E	0.879	0.99
4_I	42_L	0.876	0.99
16_L	20_L	0.875	0.99
11_E	43_K	0.873	0.99
51_E	54_E	0.870	0.99
8_F	13_L	0.851	0.99
4_I	49_L	0.828	0.98
36_T	39_N	0.816	0.98
8_F	16_L	0.784	0.98
5_F	8_F	0.780	0.98
31_A	37_N	0.778	0.98
34_T	40_W	0.769	0.97
19_A	22_K	0.715	0.96
18_D	22_K	0.715	0.96
2_M	49_L	0.697	0.95
21_R	31_A	0.682	0.95
7_G	39_N	0.674	0.94
29_L	46_L	0.661	0.94
11_E	39_N	0.645	0.93
4_I	40_W	0.639	0.93
17_L	27_I	0.638	0.93
37_N	49_L	0.633	0.92
10_E	13_L	0.617	0.91
15_A	18_D	0.616	0.91
37_N	40_W	0.605	0.91
1_E	26_P	0.593	0.90
13_L	32_V	0.591	0.90
14_D	21_R	0.589	0.90
2_M	29_L	0.575	0.88
43_K	47_E	0.569	0.88
48_E	56_M	0.567	0.88
46_L	50_A	0.565	0.87
5_F	13_L	0.559	0.87
43_K	46_L	0.557	0.87
5_F	30_K	0.548	0.86
10_E	32_V	0.538	0.85
10_E	22_K	0.525	0.83
19_A	54_E	0.524	0.83
40_W	49_L	0.520	0.83
10_E	46_L	0.513	0.82
25_L	30_K	0.511	0.82
49_L	52_E	0.505	0.81
3_L	37_N	0.503	0.81
4_I	45_L	0.501	0.81
49_L	53_H	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cxjA	3	0.6429	18	0.83	Contact Map
4ioyX	1	0.8393	16.3	0.833	Contact Map
2fe3A	2	0.8393	13.9	0.838	Contact Map
4n6cA	1	0.8929	13.3	0.84	Contact Map
3jszA	1	0.9821	13.3	0.84	Contact Map
2nrtA	1	0.9821	11.7	0.844	Contact Map
2nx9A	2	0.7679	10.1	0.848	Contact Map
3hp4A	1	1	9.5	0.85	Contact Map
1uw4B	1	1	9.4	0.85	Contact Map
2nsfA	1	0.7857	9.1	0.851	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.