DUF3782 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3782 - Protein of unknown function (DUF3782)

PFAM:	PF12644	Sequences: EEYAKLQEEIEALKEELKELRERLTKEQFKLLERYIDALGARWGIMSEEAFREGLRGILEDAGY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	64 (58)
Sequences:	645 (497)
Seq/√Len:	65.2
META:	0.865

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_F	57_G	2.803	1.00
19_E	22_E	2.509	1.00
55_L	58_I	2.502	1.00
10_I	13_L	2.314	1.00
25_T	28_Q	2.165	1.00
5_K	8_E	2.137	1.00
15_E	18_K	1.916	1.00
9_E	14_K	1.867	1.00
28_Q	32_L	1.751	1.00
38_A	41_A	1.621	0.99
13_L	17_L	1.613	0.99
14_K	17_L	1.595	0.99
41_A	52_R	1.568	0.99
54_G	57_G	1.539	0.99
16_E	21_R	1.517	0.99
15_E	19_E	1.466	0.98
24_L	28_Q	1.381	0.98
39_L	52_R	1.345	0.97
6_L	10_I	1.331	0.97
34_R	45_I	1.249	0.96
46_M	54_G	1.240	0.95
44_G	52_R	1.172	0.94
10_I	14_K	1.153	0.93
40_G	44_G	1.138	0.93
9_E	12_A	1.109	0.92
53_E	56_R	1.085	0.91
18_K	22_E	1.076	0.90
8_E	11_E	1.066	0.90
40_G	48_E	1.048	0.89
9_E	13_L	0.994	0.87
26_K	30_K	0.975	0.85
28_Q	33_E	0.954	0.84
24_L	35_Y	0.950	0.84
12_A	15_E	0.947	0.84
24_L	27_E	0.927	0.82
50_A	53_E	0.923	0.82
37_D	50_A	0.908	0.81
34_R	37_D	0.898	0.80
43_W	52_R	0.895	0.80
39_L	44_G	0.886	0.80
36_I	48_E	0.879	0.79
48_E	52_R	0.873	0.78
45_I	58_I	0.846	0.76
17_L	23_R	0.810	0.73
27_E	32_L	0.784	0.71
40_G	52_R	0.783	0.71
36_I	60_E	0.764	0.69
43_W	48_E	0.762	0.68
52_R	55_L	0.747	0.67
40_G	50_A	0.739	0.66
35_Y	46_M	0.725	0.65
42_R	48_E	0.722	0.64
17_L	21_R	0.720	0.64
33_E	37_D	0.719	0.64
39_L	43_W	0.715	0.64
13_L	20_L	0.706	0.63
39_L	45_I	0.699	0.62
46_M	49_E	0.693	0.61
40_G	43_W	0.687	0.60
25_T	29_F	0.671	0.59
39_L	42_R	0.667	0.58
42_R	45_I	0.652	0.56
32_L	35_Y	0.641	0.55
42_R	52_R	0.614	0.52
55_L	59_L	0.610	0.52
57_G	60_E	0.609	0.51
32_L	37_D	0.608	0.51
29_F	32_L	0.608	0.51
47_S	54_G	0.603	0.51
20_L	23_R	0.601	0.51
11_E	14_K	0.599	0.50
4_A	8_E	0.590	0.49
7_Q	10_I	0.584	0.49
43_W	58_I	0.554	0.45
27_E	61_D	0.552	0.45
56_R	60_E	0.551	0.45
9_E	19_E	0.549	0.44
30_K	47_S	0.545	0.44
38_A	57_G	0.545	0.44
27_E	30_K	0.533	0.43
45_I	49_E	0.530	0.42
16_E	19_E	0.525	0.42
13_L	21_R	0.524	0.42
38_A	44_G	0.513	0.40
4_A	12_A	0.510	0.40
17_L	20_L	0.509	0.40
24_L	54_G	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3vlcE	1	0.5469	10.6	0.833	Contact Map
3b2eE	1	0.5469	8.7	0.839	Contact Map
3sjbC	1	0.5312	8.4	0.84	Contact Map
3itfA	2	0.7344	7.3	0.844	Contact Map
4wwfA	2	0.6406	6.7	0.847	Contact Map
2wujA	2	0.2969	5.4	0.853	Contact Map
3a7pA	2	0.6562	5.1	0.855	Contact Map
3o39A	2	0.5938	4.9	0.856	Contact Map
1h67A	1	0.5781	4.5	0.858	Contact Map
3sjaC	1	0.4688	4.5	0.858	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.