Staygreen - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Staygreen - Staygreen protein

PFAM:	PF12638	Sequences: KLNPEKLHVTFLPGVTPTGPILPRRYTLTHSDITGDLFLTIGPEYDRKQISGLMRDEVLAEWKKDEGGLSLHVYCHVSGGGFVFGTAKWRYAIFRRELPLVLEAIRYGDRALFEAHPELDNAPIWVHFHSSNPRYNKVENWGTPADY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	147 (145)
Sequences:	784 (615)
Seq/√Len:	51.0
META:	0.703

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
106_R	120_D	6.579	1.00
74_Y	129_H	5.419	1.00
60_A	73_V	3.910	1.00
91_Y	95_R	3.909	1.00
124_I	144_P	2.925	1.00
97_E	100_L	2.860	1.00
2_L	103_E	2.786	1.00
121_N	145_A	2.779	1.00
71_L	144_P	2.633	1.00
39_L	108_G	2.480	1.00
28_L	39_L	2.313	1.00
45_Y	59_L	2.144	1.00
130_S	135_Y	2.067	1.00
62_W	122_A	1.917	0.99
12_L	40_T	1.900	0.99
113_F	144_P	1.836	0.99
73_V	126_V	1.835	0.99
46_D	49_Q	1.757	0.99
11_F	41_I	1.757	0.99
60_A	71_L	1.688	0.98
91_Y	135_Y	1.640	0.98
84_F	89_W	1.604	0.98
106_R	113_F	1.595	0.98
112_L	116_H	1.580	0.98
78_S	87_A	1.576	0.98
8_H	36_D	1.558	0.97
25_R	44_E	1.466	0.96
81_G	85_G	1.466	0.96
37_L	100_L	1.460	0.96
28_L	37_L	1.458	0.96
123_P	143_T	1.408	0.95
112_L	119_L	1.402	0.95
72_H	127_H	1.369	0.95
25_R	45_Y	1.367	0.95
94_F	98_L	1.346	0.94
32_D	56_D	1.331	0.94
29_T	55_R	1.323	0.94
25_R	61_E	1.319	0.93
51_S	81_G	1.312	0.93
95_R	139_E	1.303	0.93
33_I	63_K	1.285	0.92
64_K	69_L	1.279	0.92
91_Y	130_S	1.260	0.92
97_E	113_F	1.257	0.92
32_D	37_L	1.254	0.92
11_F	43_P	1.233	0.91
16_T	20_P	1.228	0.91
59_L	107_Y	1.222	0.90
113_F	120_D	1.220	0.90
89_W	92_A	1.195	0.89
92_A	96_R	1.149	0.88
91_Y	94_F	1.137	0.87
101_V	105_I	1.128	0.87
12_L	48_K	1.124	0.86
64_K	68_G	1.107	0.85
106_R	144_P	1.084	0.84
65_D	68_G	1.060	0.83
15_V	43_P	1.060	0.83
32_D	100_L	1.049	0.82
89_W	101_V	1.033	0.81
40_T	46_D	1.022	0.81
86_T	89_W	1.020	0.80
94_F	102_L	1.000	0.79
29_T	32_D	0.999	0.79
51_S	82_F	0.996	0.79
15_V	20_P	0.994	0.79
54_M	77_V	0.977	0.77
25_R	60_A	0.974	0.77
78_S	81_G	0.973	0.77
31_S	35_G	0.968	0.77
60_A	144_P	0.963	0.76
62_W	124_I	0.955	0.76
76_H	80_G	0.945	0.75
63_K	69_L	0.943	0.75
102_L	123_P	0.931	0.74
30_H	56_D	0.924	0.73
10_T	46_D	0.917	0.73
138_V	144_P	0.915	0.73
32_D	58_V	0.908	0.72
29_T	57_E	0.905	0.72
73_V	139_E	0.895	0.71
32_D	35_G	0.893	0.71
76_H	82_F	0.891	0.71
75_C	126_V	0.883	0.70
35_G	81_G	0.880	0.70
120_D	144_P	0.879	0.70
83_V	86_T	0.878	0.69
111_A	114_E	0.869	0.69
12_L	46_D	0.868	0.69
80_G	87_A	0.866	0.68
31_S	38_F	0.861	0.68
7_L	39_L	0.856	0.68
17_P	111_A	0.853	0.67
41_I	109_D	0.851	0.67
35_G	57_E	0.847	0.67
20_P	112_L	0.846	0.67
121_N	137_K	0.836	0.66
30_H	34_T	0.805	0.63
31_S	108_G	0.804	0.63
75_C	78_S	0.800	0.62
80_G	83_V	0.796	0.62
88_K	135_Y	0.783	0.61
15_V	110_R	0.783	0.61
98_L	128_F	0.780	0.60
124_I	143_T	0.779	0.60
63_K	135_Y	0.777	0.60
7_L	108_G	0.768	0.59
45_Y	91_Y	0.763	0.59
140_N	143_T	0.753	0.58
41_I	131_S	0.752	0.57
78_S	91_Y	0.751	0.57
40_T	49_Q	0.746	0.57
17_P	123_P	0.744	0.57
76_H	81_G	0.744	0.57
114_E	135_Y	0.742	0.56
21_I	69_L	0.738	0.56
24_R	27_T	0.735	0.56
69_L	122_A	0.724	0.55
54_M	82_F	0.723	0.55
11_F	19_G	0.717	0.54
53_L	76_H	0.717	0.54
32_D	55_R	0.716	0.54
73_V	97_E	0.716	0.54
129_H	136_N	0.715	0.54
125_W	140_N	0.714	0.54
10_T	17_P	0.702	0.52
75_C	125_W	0.699	0.52
111_A	126_V	0.698	0.52
22_L	41_I	0.696	0.52
3_N	70_S	0.695	0.52
56_D	93_I	0.694	0.52
121_N	143_T	0.694	0.52
68_G	123_P	0.693	0.51
43_P	121_N	0.691	0.51
74_Y	136_N	0.690	0.51
35_G	55_R	0.683	0.50
20_P	144_P	0.680	0.50
3_N	92_A	0.672	0.49
96_R	141_W	0.671	0.49
10_T	49_Q	0.670	0.49
75_C	98_L	0.668	0.49
29_T	56_D	0.668	0.49
30_H	58_V	0.665	0.49
107_Y	110_R	0.664	0.48
54_M	81_G	0.660	0.48
103_E	106_R	0.657	0.48
86_T	121_N	0.656	0.48
94_F	109_D	0.655	0.47
16_T	143_T	0.641	0.46
63_K	74_Y	0.633	0.45
111_A	144_P	0.633	0.45
25_R	47_R	0.632	0.45
53_L	121_N	0.631	0.45
85_G	89_W	0.622	0.44
102_L	146_D	0.622	0.44
22_L	82_F	0.621	0.44
32_D	57_E	0.621	0.44
101_V	104_A	0.621	0.44
31_S	57_E	0.618	0.44
37_L	56_D	0.614	0.43
38_F	147_Y	0.609	0.43
87_A	131_S	0.608	0.43
6_K	36_D	0.608	0.43
12_L	16_T	0.605	0.42
35_G	56_D	0.604	0.42
45_Y	51_S	0.602	0.42
11_F	42_G	0.598	0.42
23_P	43_P	0.596	0.41
105_I	116_H	0.595	0.41
11_F	17_P	0.594	0.41
55_R	59_L	0.592	0.41
125_W	138_V	0.591	0.41
90_R	93_I	0.591	0.41
107_Y	111_A	0.588	0.41
67_G	118_E	0.582	0.40
8_H	144_P	0.582	0.40
80_G	85_G	0.579	0.40
27_T	55_R	0.576	0.39
22_L	64_K	0.576	0.39
46_D	78_S	0.576	0.39
33_I	86_T	0.571	0.39
84_F	141_W	0.571	0.39
18_T	95_R	0.571	0.39
33_I	89_W	0.568	0.39
78_S	89_W	0.563	0.38
37_L	93_I	0.559	0.38
66_E	119_L	0.556	0.38
133_P	145_A	0.553	0.37
36_D	58_V	0.550	0.37
120_D	145_A	0.547	0.37
35_G	88_K	0.547	0.37
53_L	85_G	0.547	0.37
53_L	89_W	0.543	0.36
64_K	112_L	0.542	0.36
60_A	139_E	0.538	0.36
81_G	84_F	0.536	0.36
19_G	111_A	0.535	0.35
40_T	92_A	0.531	0.35
88_K	112_L	0.531	0.35
30_H	55_R	0.530	0.35
77_V	98_L	0.529	0.35
37_L	107_Y	0.524	0.34
49_Q	52_G	0.523	0.34
5_E	18_T	0.522	0.34
33_I	67_G	0.520	0.34
75_C	124_I	0.519	0.34
29_T	54_M	0.517	0.34
13_P	118_E	0.513	0.33
30_H	57_E	0.512	0.33
53_L	81_G	0.511	0.33
10_T	13_P	0.510	0.33
44_E	47_R	0.509	0.33
38_F	93_I	0.506	0.33
41_I	44_E	0.502	0.32
17_P	20_P	0.501	0.32
31_S	39_L	0.500	0.32
99_P	114_E	0.500	0.32
51_S	77_V	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nttA	6	0.9592	10.9	0.952	Contact Map
2g8gA	7	0.966	9.9	0.953	Contact Map
4dpvZ	8	0.9728	8.2	0.955	Contact Map
1s58A	7	0.9864	7.5	0.955	Contact Map
3owrA	1	0.3061	7.1	0.956	Contact Map
1wz3A	2	0.483	6.5	0.957	Contact Map
3w1sC	1	0.4286	6.3	0.957	Contact Map
4hczA	1	0.3401	6.2	0.957	Contact Map
3ng9A	7	0.9456	5.7	0.958	Contact Map
2r2qA	1	0.483	5.7	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.