PHM7_ext - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PHM7_ext - Extracellular tail, of 10TM putative phosphate transporter

PFAM:	PF12621	Sequences: FLHPHIYADYATLRRLVPDDYADETPEYTEELERNAYLHPAVTSKTPLLWIPRDPLGVSRQEVAHTSKVIPITDEGATLDEKGKVVWDGRPPD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (92)
Sequences:	690 (486)
Seq/√Len:	50.7
META:	0.313

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_S	74_D	4.224	1.00
77_A	85_V	2.959	1.00
9_D	12_T	2.756	1.00
53_R	60_R	2.610	1.00
80_D	86_V	2.598	1.00
80_D	84_K	2.357	1.00
53_R	74_D	2.234	1.00
63_V	72_I	2.217	1.00
35_N	38_L	2.209	1.00
66_T	72_I	2.172	1.00
53_R	59_S	2.172	1.00
76_G	89_G	2.157	1.00
60_R	74_D	2.146	1.00
51_I	72_I	1.807	0.99
79_L	86_V	1.675	0.98
30_E	34_R	1.618	0.98
48_L	73_T	1.591	0.98
60_R	63_V	1.568	0.97
3_H	6_I	1.555	0.97
51_I	66_T	1.501	0.97
1_F	9_D	1.494	0.97
52_P	76_G	1.472	0.96
79_L	85_V	1.440	0.96
88_D	91_P	1.387	0.95
29_T	32_L	1.385	0.95
62_E	66_T	1.374	0.95
10_Y	14_R	1.367	0.94
49_L	70_I	1.354	0.94
61_Q	65_H	1.297	0.93
6_I	12_T	1.283	0.92
69_V	72_I	1.236	0.91
57_G	75_E	1.188	0.89
37_Y	44_S	1.181	0.89
89_G	92_P	1.158	0.88
2_L	7_Y	1.135	0.87
56_L	79_L	1.127	0.86
41_A	62_E	1.084	0.84
51_I	62_E	1.083	0.84
4_P	7_Y	1.067	0.83
59_S	63_V	1.051	0.82
61_Q	64_A	1.028	0.81
8_A	12_T	1.014	0.80
2_L	68_K	1.009	0.79
58_V	65_H	1.007	0.79
2_L	13_L	0.979	0.77
29_T	46_T	0.977	0.77
6_I	23_D	0.963	0.76
20_D	24_E	0.955	0.76
5_H	39_H	0.945	0.75
1_F	8_A	0.942	0.75
6_I	9_D	0.923	0.73
72_I	83_G	0.914	0.72
12_T	83_G	0.879	0.69
62_E	65_H	0.875	0.69
37_Y	79_L	0.855	0.67
37_Y	47_P	0.854	0.67
55_P	81_E	0.851	0.67
39_H	77_A	0.847	0.66
7_Y	17_V	0.845	0.66
41_A	57_G	0.841	0.66
1_F	16_L	0.832	0.65
22_A	88_D	0.830	0.65
79_L	83_G	0.808	0.63
51_I	70_I	0.801	0.62
4_P	14_R	0.801	0.62
28_Y	74_D	0.790	0.61
33_E	38_L	0.783	0.60
23_D	27_E	0.780	0.60
37_Y	40_P	0.776	0.60
6_I	21_Y	0.775	0.59
61_Q	66_T	0.771	0.59
64_A	83_G	0.765	0.59
20_D	23_D	0.757	0.58
6_I	22_A	0.757	0.58
12_T	15_R	0.752	0.57
20_D	88_D	0.750	0.57
3_H	7_Y	0.746	0.57
29_T	42_V	0.729	0.55
10_Y	18_P	0.727	0.55
45_K	83_G	0.725	0.54
51_I	61_Q	0.724	0.54
18_P	55_P	0.721	0.54
1_F	11_A	0.716	0.54
44_S	47_P	0.710	0.53
58_V	84_K	0.709	0.53
39_H	42_V	0.709	0.53
77_A	87_W	0.701	0.52
18_P	25_T	0.697	0.52
78_T	86_V	0.696	0.51
7_Y	61_Q	0.680	0.50
18_P	28_Y	0.677	0.50
82_K	86_V	0.667	0.48
31_E	35_N	0.661	0.48
58_V	70_I	0.646	0.46
71_P	75_E	0.642	0.46
5_H	8_A	0.641	0.46
8_A	79_L	0.637	0.45
78_T	83_G	0.636	0.45
60_R	64_A	0.635	0.45
76_G	90_R	0.634	0.45
41_A	59_S	0.623	0.44
23_D	71_P	0.622	0.44
16_L	20_D	0.620	0.44
21_Y	24_E	0.607	0.42
53_R	88_D	0.606	0.42
3_H	41_A	0.593	0.41
35_N	48_L	0.590	0.41
36_A	44_S	0.590	0.41
87_W	90_R	0.589	0.41
31_E	84_K	0.585	0.40
27_E	55_P	0.585	0.40
1_F	48_L	0.577	0.39
3_H	9_D	0.575	0.39
64_A	81_E	0.575	0.39
54_D	57_G	0.573	0.39
41_A	86_V	0.569	0.39
49_L	71_P	0.568	0.38
3_H	39_H	0.568	0.38
62_E	72_I	0.562	0.38
19_D	45_K	0.560	0.38
45_K	86_V	0.555	0.37
7_Y	10_Y	0.548	0.37
1_F	6_I	0.543	0.36
25_T	28_Y	0.543	0.36
10_Y	13_L	0.540	0.36
48_L	84_K	0.539	0.36
5_H	41_A	0.538	0.36
1_F	12_T	0.537	0.35
28_Y	59_S	0.534	0.35
78_T	85_V	0.524	0.34
78_T	88_D	0.519	0.34
39_H	51_I	0.519	0.34
3_H	45_K	0.513	0.33
30_E	33_E	0.511	0.33
9_D	52_P	0.506	0.33
34_R	47_P	0.505	0.33
22_A	31_E	0.504	0.32
42_V	85_V	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yorA	2	0.8172	10.1	0.915	Contact Map
4h3wA	1	0.871	6.9	0.921	Contact Map
4x9rA	1	0.7849	6.5	0.922	Contact Map
1ao0A	3	0.9892	6.5	0.922	Contact Map
3kj0B	1	0.2581	6.4	0.922	Contact Map
4tmaI	1	0.5269	6.4	0.922	Contact Map
2ciwA	1	0.7957	6.2	0.922	Contact Map
1jgtA	2	0.957	5.7	0.924	Contact Map
4dloA	1	0.3118	5.6	0.924	Contact Map
2ycuA	1	0.5591	5.6	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.