DUF3774 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3774 - Wound-induced protein

PFAM:	PF12609	Sequences: VAASVGAVEALKDQGLCRWNYALRSLHQHAKNNVRSLSQAKKLSSSSSSSAARDEKAKQSEESLRTVMYLSCWGP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (75)
Sequences:	516 (384)
Seq/√Len:	44.3
META:	0.101

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_L	30_A	3.083	1.00
65_R	71_S	2.670	1.00
71_S	75_P	2.529	1.00
65_R	69_Y	2.347	1.00
60_S	69_Y	2.029	0.99
16_L	22_A	1.920	0.99
67_V	71_S	1.766	0.98
40_A	44_S	1.759	0.98
63_S	69_Y	1.622	0.97
18_R	21_Y	1.572	0.96
6_G	11_L	1.535	0.96
63_S	68_M	1.512	0.95
62_E	65_R	1.492	0.95
64_L	69_Y	1.478	0.95
68_M	71_S	1.478	0.95
13_D	24_R	1.413	0.93
60_S	63_S	1.408	0.93
53_R	57_A	1.364	0.92
19_W	27_H	1.345	0.91
66_T	71_S	1.327	0.91
63_S	71_S	1.322	0.91
21_Y	24_R	1.315	0.90
54_D	57_A	1.276	0.89
59_Q	65_R	1.254	0.88
14_Q	24_R	1.250	0.88
46_S	57_A	1.226	0.87
16_L	26_L	1.216	0.87
64_L	72_C	1.215	0.87
3_A	6_G	1.208	0.86
59_Q	69_Y	1.201	0.86
61_E	75_P	1.195	0.86
12_K	75_P	1.176	0.85
17_C	22_A	1.164	0.84
2_A	5_V	1.127	0.82
62_E	73_W	1.068	0.79
39_Q	42_K	1.060	0.78
7_A	59_Q	1.044	0.77
32_N	48_S	1.040	0.77
35_R	44_S	1.034	0.76
21_Y	27_H	1.033	0.76
6_G	65_R	1.031	0.76
8_V	15_G	1.029	0.76
11_L	17_C	1.012	0.75
11_L	30_A	0.999	0.74
63_S	72_C	0.999	0.74
28_Q	32_N	0.971	0.72
55_E	60_S	0.964	0.71
15_G	19_W	0.962	0.71
9_E	18_R	0.939	0.69
26_L	33_N	0.935	0.69
3_A	63_S	0.934	0.69
35_R	48_S	0.924	0.68
5_V	26_L	0.915	0.67
10_A	27_H	0.912	0.67
64_L	71_S	0.882	0.64
60_S	65_R	0.850	0.61
33_N	72_C	0.846	0.61
3_A	66_T	0.833	0.60
57_A	64_L	0.827	0.59
23_L	28_Q	0.824	0.59
20_N	67_V	0.811	0.58
4_S	9_E	0.804	0.57
68_M	72_C	0.797	0.56
36_S	39_Q	0.795	0.56
9_E	12_K	0.793	0.56
19_W	23_L	0.790	0.56
45_S	50_S	0.779	0.55
7_A	43_L	0.773	0.54
3_A	54_D	0.771	0.54
1_V	10_A	0.764	0.53
14_Q	25_S	0.751	0.52
6_G	33_N	0.748	0.52
23_L	55_E	0.744	0.51
34_V	38_S	0.732	0.50
10_A	19_W	0.730	0.50
37_L	40_A	0.730	0.50
35_R	38_S	0.728	0.50
30_A	75_P	0.726	0.49
7_A	12_K	0.707	0.48
35_R	45_S	0.704	0.47
7_A	33_N	0.678	0.45
1_V	12_K	0.678	0.45
69_Y	73_W	0.673	0.44
5_V	16_L	0.666	0.44
54_D	66_T	0.660	0.43
13_D	18_R	0.655	0.43
36_S	67_V	0.653	0.42
53_R	58_K	0.652	0.42
6_G	9_E	0.650	0.42
20_N	24_R	0.647	0.42
30_A	56_K	0.639	0.41
61_E	68_M	0.636	0.41
55_E	59_Q	0.618	0.39
6_G	17_C	0.616	0.39
27_H	55_E	0.612	0.39
10_A	32_N	0.612	0.39
65_R	73_W	0.596	0.37
3_A	72_C	0.591	0.37
60_S	66_T	0.588	0.36
62_E	69_Y	0.575	0.35
7_A	72_C	0.574	0.35
61_E	67_V	0.572	0.35
4_S	27_H	0.571	0.35
20_N	75_P	0.544	0.33
11_L	75_P	0.542	0.32
29_H	33_N	0.540	0.32
61_E	66_T	0.539	0.32
9_E	19_W	0.537	0.32
1_V	75_P	0.536	0.32
13_D	21_Y	0.510	0.30
52_A	62_E	0.501	0.29
5_V	20_N	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ki9A	1	0.2533	4.4	0.919	Contact Map
4phuA	1	0.96	2.3	0.93	Contact Map
3wv7A	3	0.2267	2.2	0.931	Contact Map
4s28A	2	0.8667	2	0.933	Contact Map
4s0vA	1	0.9467	1.9	0.933	Contact Map
3epoA	2	0.8	1.8	0.934	Contact Map
3tacB	1	0.3467	1.7	0.935	Contact Map
2r4rA	1	0.6133	1.6	0.936	Contact Map
4xesA	1	0.48	1.5	0.937	Contact Map
4m3pA	4	0.76	1.5	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.