DUF3768 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3768 - Protein of unknown function (DUF3768)

PFAM:	PF12599	Sequences: MTAGVAALGPEAVARILAAVRTFDDFTEDNDPHGEHDFGSFEVDGEKIFWKIDYYDRDLEYGSPDPADPAVTTRVLTIMLAEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (83)
Sequences:	5267 (3717)
Seq/√Len:	408.0
META:	0.949

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_G	50_W	2.698	1.00
56_D	61_Y	2.470	1.00
18_A	22_T	2.213	1.00
59_L	73_T	2.170	1.00
64_P	71_V	2.078	1.00
40_S	47_K	2.062	1.00
4_G	83_E	2.050	1.00
9_G	12_A	2.022	1.00
6_A	13_V	1.788	1.00
16_I	43_V	1.778	1.00
9_G	13_V	1.778	1.00
19_A	43_V	1.762	1.00
15_R	44_D	1.747	1.00
40_S	49_F	1.740	1.00
56_D	60_E	1.727	1.00
31_D	36_H	1.722	1.00
12_A	16_I	1.718	1.00
5_V	48_I	1.694	1.00
48_I	80_L	1.692	1.00
68_D	71_V	1.690	1.00
38_F	49_F	1.633	1.00
57_R	73_T	1.592	1.00
18_A	21_R	1.568	1.00
42_E	47_K	1.551	1.00
12_A	43_V	1.508	1.00
63_S	72_T	1.467	1.00
16_I	48_I	1.434	1.00
62_G	66_P	1.431	1.00
8_L	12_A	1.409	1.00
41_F	48_I	1.312	1.00
20_V	78_I	1.304	1.00
12_A	44_D	1.286	1.00
17_L	21_R	1.276	1.00
63_S	71_V	1.272	1.00
1_M	6_A	1.256	1.00
15_R	19_A	1.251	1.00
3_A	7_A	1.223	1.00
10_P	13_V	1.190	1.00
35_E	54_Y	1.184	1.00
49_F	79_M	1.162	1.00
8_L	46_E	1.081	1.00
46_E	82_E	1.056	1.00
57_R	64_P	1.011	1.00
19_A	41_F	1.006	1.00
10_P	14_A	1.005	1.00
3_A	6_A	0.998	1.00
28_E	34_G	0.993	1.00
4_G	80_L	0.946	1.00
49_F	81_A	0.918	1.00
54_Y	72_T	0.916	1.00
14_A	17_L	0.877	1.00
20_V	41_F	0.873	1.00
16_I	20_V	0.853	1.00
58_D	61_Y	0.848	1.00
27_T	30_N	0.847	1.00
47_K	81_A	0.844	1.00
13_V	17_L	0.843	1.00
16_I	78_I	0.828	1.00
15_R	18_A	0.824	1.00
23_F	26_F	0.804	1.00
5_V	16_I	0.802	1.00
20_V	76_L	0.797	1.00
65_D	71_V	0.761	1.00
42_E	45_G	0.757	1.00
23_F	41_F	0.756	1.00
46_E	80_L	0.756	1.00
52_I	76_L	0.754	1.00
14_A	18_A	0.753	1.00
39_G	76_L	0.752	1.00
12_A	48_I	0.738	1.00
12_A	15_R	0.732	1.00
6_A	10_P	0.726	1.00
6_A	9_G	0.724	1.00
30_N	38_F	0.719	1.00
14_A	21_R	0.710	1.00
15_R	43_V	0.687	1.00
68_D	72_T	0.676	0.99
80_L	83_E	0.666	0.99
16_I	41_F	0.663	0.99
19_A	22_T	0.660	0.99
11_E	14_A	0.653	0.99
63_S	67_A	0.653	0.99
5_V	8_L	0.651	0.99
62_G	73_T	0.650	0.99
4_G	48_I	0.642	0.99
23_F	30_N	0.642	0.99
56_D	59_L	0.639	0.99
12_A	46_E	0.631	0.99
19_A	25_D	0.628	0.99
9_G	16_I	0.627	0.99
17_L	78_I	0.617	0.99
43_V	48_I	0.614	0.99
66_P	72_T	0.607	0.99
56_D	63_S	0.605	0.99
39_G	49_F	0.605	0.99
63_S	66_P	0.596	0.99
54_Y	67_A	0.593	0.99
33_H	37_D	0.590	0.99
43_V	50_W	0.584	0.99
5_V	20_V	0.574	0.98
63_S	68_D	0.563	0.98
27_T	33_H	0.559	0.98
54_Y	62_G	0.556	0.98
1_M	17_L	0.556	0.98
54_Y	65_D	0.554	0.98
54_Y	59_L	0.554	0.98
57_R	71_V	0.550	0.98
67_A	72_T	0.545	0.98
50_W	76_L	0.544	0.98
5_V	13_V	0.539	0.98
9_G	48_I	0.535	0.97
53_D	77_T	0.535	0.97
30_N	40_S	0.534	0.97
57_R	61_Y	0.519	0.97
10_P	18_A	0.518	0.97
4_G	7_A	0.517	0.97
33_H	38_F	0.512	0.97
64_P	67_A	0.511	0.97
23_F	27_T	0.510	0.97
11_E	15_R	0.509	0.97
11_E	18_A	0.507	0.96
37_D	54_Y	0.506	0.96
37_D	51_K	0.502	0.96
7_A	11_E	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2r41A	5	0.9277	14.5	0.91	Contact Map
2jnsA	1	0.7711	11	0.915	Contact Map
1bm4A	1	0.3133	8.8	0.919	Contact Map
1i4oC	1	0	6.4	0.924	Contact Map
3sxuB	1	0.3373	5.4	0.926	Contact Map
2hr3A	2	0.3735	4.8	0.928	Contact Map
4l9nA	2	0.3494	4.4	0.929	Contact Map
4pqxA	2	0.5904	4.3	0.93	Contact Map
3op9A	4	0.3494	4.1	0.93	Contact Map
2q5xA	1	0.7349	3.9	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.