WBS_methylT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WBS_methylT - Methyltransferase involved in Williams-Beuren syndrome

PFAM:	PF12589	Sequences: LFAGPGGSQQLPKGLGGEEEEEEEEMETVRFEDRRRRRKKRKGKKKKGKKSREWILKKKERRRRQGKEVRPDSKYTGRKRKP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (79)
Sequences:	600 (473)
Seq/√Len:	53.2
META:	0.307

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_R	65_Q	6.135	1.00
55_I	77_G	4.914	1.00
63_R	72_D	3.456	1.00
3_A	7_G	2.465	1.00
62_R	65_Q	2.237	1.00
62_R	70_R	2.186	1.00
50_K	54_W	1.826	0.99
56_L	72_D	1.683	0.99
57_K	61_R	1.673	0.99
32_E	35_R	1.630	0.98
57_K	62_R	1.471	0.97
1_L	4_G	1.446	0.96
46_K	49_K	1.437	0.96
57_K	65_Q	1.425	0.96
11_L	14_G	1.424	0.96
61_R	70_R	1.376	0.95
34_R	41_R	1.369	0.95
2_F	7_G	1.346	0.95
61_R	67_K	1.340	0.95
31_F	35_R	1.295	0.93
45_K	49_K	1.247	0.92
55_I	74_K	1.231	0.92
47_K	51_S	1.231	0.92
15_L	57_K	1.184	0.90
59_K	63_R	1.166	0.89
59_K	76_T	1.163	0.89
56_L	70_R	1.125	0.88
7_G	10_Q	1.106	0.87
14_G	17_G	1.106	0.87
16_G	53_E	1.097	0.86
70_R	73_S	1.087	0.86
56_L	73_S	1.084	0.85
59_K	72_D	1.046	0.83
14_G	60_E	1.040	0.83
52_R	56_L	1.024	0.82
31_F	34_R	1.023	0.82
51_S	54_W	0.991	0.80
33_D	76_T	0.991	0.80
42_K	47_K	0.988	0.80
34_R	38_R	0.978	0.79
51_S	64_R	0.970	0.78
16_G	19_E	0.968	0.78
42_K	45_K	0.946	0.77
62_R	69_V	0.933	0.76
3_A	9_Q	0.932	0.76
8_S	33_D	0.922	0.75
9_Q	18_E	0.888	0.72
38_R	52_R	0.887	0.72
33_D	36_R	0.886	0.72
65_Q	70_R	0.873	0.71
60_E	67_K	0.853	0.69
76_T	80_R	0.842	0.68
77_G	80_R	0.821	0.66
13_K	16_G	0.808	0.65
12_P	15_L	0.799	0.64
37_R	40_K	0.784	0.62
56_L	76_T	0.767	0.61
32_E	39_K	0.765	0.60
75_Y	78_R	0.746	0.59
38_R	41_R	0.743	0.58
14_G	71_P	0.742	0.58
34_R	37_R	0.741	0.58
62_R	75_Y	0.739	0.58
75_Y	80_R	0.738	0.58
56_L	63_R	0.737	0.58
13_K	35_R	0.733	0.57
27_E	36_R	0.732	0.57
38_R	46_K	0.729	0.57
43_G	46_K	0.727	0.57
9_Q	19_E	0.722	0.56
2_F	14_G	0.721	0.56
51_S	77_G	0.714	0.55
16_G	21_E	0.713	0.55
11_L	15_L	0.713	0.55
33_D	40_K	0.706	0.54
29_V	64_R	0.699	0.54
12_P	16_G	0.692	0.53
51_S	57_K	0.688	0.52
45_K	79_K	0.687	0.52
2_F	10_Q	0.687	0.52
36_R	39_K	0.683	0.52
48_G	73_S	0.683	0.52
13_K	53_E	0.682	0.52
19_E	25_E	0.679	0.52
60_E	64_R	0.675	0.51
40_K	50_K	0.672	0.51
71_P	75_Y	0.658	0.49
30_R	33_D	0.647	0.48
18_E	22_E	0.643	0.48
45_K	52_R	0.636	0.47
10_Q	74_K	0.621	0.45
31_F	42_K	0.619	0.45
51_S	61_R	0.607	0.44
47_K	81_K	0.606	0.44
16_G	20_E	0.606	0.44
39_K	56_L	0.603	0.44
75_Y	81_K	0.601	0.43
12_P	72_D	0.597	0.43
53_E	77_G	0.594	0.43
2_F	74_K	0.579	0.41
3_A	74_K	0.574	0.41
31_F	39_K	0.572	0.40
37_R	70_R	0.572	0.40
58_K	63_R	0.570	0.40
64_R	68_E	0.562	0.39
21_E	53_E	0.558	0.39
10_Q	57_K	0.553	0.38
17_G	20_E	0.552	0.38
48_G	53_E	0.545	0.38
38_R	65_Q	0.539	0.37
50_K	75_Y	0.539	0.37
26_M	29_V	0.534	0.37
45_K	55_I	0.533	0.36
51_S	70_R	0.530	0.36
38_R	68_E	0.520	0.35
64_R	75_Y	0.519	0.35
11_L	28_T	0.502	0.33
10_Q	42_K	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3uwpA	1	0	62	0.846	Contact Map
4cidA	2	0.2927	2.2	0.927	Contact Map
4qitA	2	0.3293	2	0.929	Contact Map
4hsuA	1	0.3902	1.7	0.931	Contact Map
3k7mX	2	0.3902	1.6	0.932	Contact Map
1g60A	2	0.4634	1.5	0.933	Contact Map
1rsgA	2	0.4756	1.4	0.934	Contact Map
5a1uC	1	0	1.3	0.935	Contact Map
4akfA	2	0.1341	1.2	0.936	Contact Map
4aajA	1	0.6098	1.2	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.