DUF3761 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3761 - Protein of unknown function (DUF3761)

PFAM:	PF12587	Sequences: CAALLLALALLAAPAAAKAAAAAAPAEADLSNHGYYTNSDGNTVHSPAHSSSGAAPAGATAQCRDGTYSFSQHRRGTCSHHGGVARWL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	88 (78)
Sequences:	1057 (907)
Seq/√Len:	102.7
META:	0.904

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_N	72_Q	6.099	1.00
40_D	73_H	4.116	1.00
45_H	48_A	2.865	1.00
62_Q	86_R	2.732	1.00
61_A	69_S	2.620	1.00
37_T	43_T	2.506	1.00
35_Y	43_T	2.154	1.00
55_A	88_L	1.817	1.00
71_S	77_T	1.713	1.00
39_S	73_H	1.711	1.00
59_A	68_Y	1.641	1.00
56_P	68_Y	1.640	1.00
49_H	67_T	1.633	1.00
34_G	46_S	1.608	1.00
40_D	72_Q	1.559	1.00
55_A	70_F	1.434	1.00
18_K	22_A	1.370	1.00
76_G	79_S	1.342	0.99
32_N	49_H	1.258	0.99
64_R	85_A	1.246	0.99
78_C	81_H	1.222	0.99
36_Y	44_V	1.202	0.99
55_A	68_Y	1.183	0.99
48_A	70_F	1.129	0.98
38_N	45_H	1.111	0.98
12_A	19_A	1.099	0.98
27_E	33_H	1.081	0.97
32_N	48_A	1.070	0.97
71_S	84_V	1.067	0.97
16_A	20_A	1.041	0.97
31_S	49_H	1.032	0.96
36_Y	41_G	1.030	0.96
84_V	87_W	0.991	0.96
37_T	41_G	0.987	0.95
26_A	33_H	0.979	0.95
31_S	43_T	0.966	0.95
66_G	77_T	0.962	0.95
30_L	48_A	0.945	0.94
12_A	22_A	0.931	0.94
69_S	79_S	0.929	0.94
19_A	29_D	0.922	0.93
35_Y	45_H	0.920	0.93
78_C	83_G	0.919	0.93
26_A	29_D	0.918	0.93
56_P	59_A	0.917	0.93
75_R	79_S	0.911	0.93
36_Y	47_P	0.906	0.93
71_S	75_R	0.903	0.93
12_A	16_A	0.897	0.93
73_H	77_T	0.892	0.92
23_A	26_A	0.880	0.92
41_G	47_P	0.862	0.91
11_L	16_A	0.859	0.91
16_A	19_A	0.857	0.91
74_R	87_W	0.842	0.90
52_S	55_A	0.833	0.89
74_R	88_L	0.824	0.89
25_P	33_H	0.823	0.89
13_A	20_A	0.817	0.89
69_S	77_T	0.799	0.87
61_A	77_T	0.794	0.87
61_A	88_L	0.794	0.87
44_V	47_P	0.793	0.87
50_S	57_A	0.759	0.85
23_A	28_A	0.758	0.85
38_N	47_P	0.745	0.84
47_P	56_P	0.744	0.83
34_G	45_H	0.735	0.83
13_A	16_A	0.726	0.82
50_S	55_A	0.726	0.82
44_V	72_Q	0.689	0.78
50_S	53_G	0.687	0.78
22_A	25_P	0.675	0.77
25_P	30_L	0.671	0.77
56_P	70_F	0.670	0.77
59_A	70_F	0.667	0.76
58_G	70_F	0.666	0.76
14_P	19_A	0.663	0.76
46_S	50_S	0.663	0.76
37_T	74_R	0.657	0.75
29_D	33_H	0.654	0.75
79_S	82_G	0.652	0.75
64_R	80_H	0.649	0.74
71_S	76_G	0.637	0.73
36_Y	77_T	0.635	0.73
60_T	63_C	0.633	0.72
58_G	68_Y	0.632	0.72
78_C	82_G	0.623	0.71
76_G	81_H	0.610	0.70
37_T	45_H	0.601	0.69
74_R	85_A	0.594	0.68
16_A	21_A	0.590	0.67
12_A	20_A	0.589	0.67
63_C	66_G	0.589	0.67
13_A	18_K	0.589	0.67
62_Q	85_A	0.583	0.66
77_T	87_W	0.579	0.66
81_H	84_V	0.569	0.64
11_L	21_A	0.568	0.64
77_T	84_V	0.568	0.64
58_G	86_R	0.566	0.64
64_R	67_T	0.563	0.64
22_A	26_A	0.558	0.63
18_K	21_A	0.544	0.61
11_L	23_A	0.539	0.60
41_G	44_V	0.538	0.60
24_A	28_A	0.537	0.60
14_P	18_K	0.534	0.59
33_H	45_H	0.533	0.59
77_T	80_H	0.533	0.59
65_D	81_H	0.531	0.59
62_Q	66_G	0.520	0.57
30_L	45_H	0.520	0.57
25_P	29_D	0.519	0.57
57_A	80_H	0.509	0.56
13_A	17_A	0.506	0.55
35_Y	46_S	0.500	0.55

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4uz1A	1	0.375	9.4	0.902	Contact Map
4uzkA	2	0.3636	7.5	0.906	Contact Map
4ixjA	1	0.7955	3.5	0.92	Contact Map
2k1iA	1	0.3295	2.3	0.927	Contact Map
3qteA	2	0.3295	1.9	0.931	Contact Map
4rbxA	1	0.3295	1.8	0.931	Contact Map
4ei0A	2	0.9318	1.7	0.932	Contact Map
4m4pA	1	0.5795	1.5	0.935	Contact Map
1zmmA	1	0.3182	1.4	0.935	Contact Map
4wbhA	2	0.375	1.4	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.