DUF3759 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3759 - Protein of unknown function (DUF3759)

PFAM:	PF12585	Sequences: AYDQVYNAPHKAKLSHELIAGAAAFEAAKAYEDHQAKNGKPVSHAKAKELLAGFAGAFVDRLVETKGLDFIDREKAKHHAKEQAEEAYDQH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	91 (88)
Sequences:	728 (556)
Seq/√Len:	59.3
META:	0.547

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_L	54_F	3.583	1.00
25_F	46_K	3.165	1.00
20_A	24_A	2.297	1.00
33_D	37_K	2.119	1.00
58_F	62_L	2.116	1.00
81_K	85_E	1.986	1.00
21_G	53_G	1.845	1.00
24_A	56_G	1.789	0.99
70_F	74_E	1.775	0.99
12_A	61_R	1.768	0.99
32_E	49_E	1.727	0.99
30_A	33_D	1.718	0.99
78_H	81_K	1.663	0.99
75_K	78_H	1.651	0.99
63_V	68_L	1.632	0.99
35_Q	40_K	1.629	0.99
84_A	88_Y	1.597	0.99
62_L	66_K	1.595	0.99
21_G	24_A	1.595	0.99
31_Y	35_Q	1.589	0.99
29_K	33_D	1.584	0.99
26_E	30_A	1.537	0.98
36_A	42_V	1.418	0.97
35_Q	42_V	1.396	0.97
74_E	77_K	1.358	0.96
8_A	14_L	1.322	0.96
74_E	78_H	1.300	0.95
51_L	84_A	1.289	0.95
79_H	82_E	1.264	0.94
46_K	49_E	1.264	0.94
78_H	82_E	1.254	0.94
33_D	36_A	1.242	0.94
79_H	83_Q	1.203	0.93
63_V	71_I	1.186	0.92
42_V	46_K	1.178	0.92
8_A	11_K	1.153	0.91
14_L	18_L	1.138	0.91
10_H	68_L	1.137	0.91
34_H	54_F	1.121	0.90
21_G	57_A	1.116	0.90
3_D	7_N	1.103	0.89
2_Y	6_Y	1.102	0.89
23_A	58_F	1.101	0.89
32_E	42_V	1.096	0.89
68_L	71_I	1.083	0.88
58_F	61_R	1.078	0.88
12_A	17_E	1.076	0.88
84_A	87_A	1.072	0.88
56_G	60_D	1.020	0.85
86_E	89_D	0.998	0.84
55_A	88_Y	0.986	0.83
74_E	81_K	0.978	0.83
30_A	34_H	0.972	0.82
46_K	50_L	0.970	0.82
23_A	59_V	0.955	0.81
42_V	45_A	0.947	0.81
20_A	28_A	0.942	0.80
19_I	26_E	0.915	0.78
20_A	79_H	0.906	0.78
6_Y	9_P	0.904	0.77
2_Y	9_P	0.895	0.77
24_A	27_A	0.885	0.76
82_E	85_E	0.865	0.74
69_D	72_D	0.864	0.74
5_V	8_A	0.848	0.73
24_A	28_A	0.839	0.72
36_A	45_A	0.832	0.71
38_N	41_P	0.809	0.69
42_V	48_K	0.807	0.69
27_A	63_V	0.807	0.69
85_E	89_D	0.803	0.69
51_L	83_Q	0.802	0.69
19_I	29_K	0.794	0.68
60_D	77_K	0.788	0.67
5_V	62_L	0.780	0.66
76_A	80_A	0.778	0.66
65_T	69_D	0.771	0.66
4_Q	8_A	0.768	0.65
81_K	84_A	0.762	0.65
41_P	47_A	0.760	0.64
13_K	61_R	0.760	0.64
24_A	83_Q	0.757	0.64
34_H	38_N	0.748	0.63
3_D	6_Y	0.736	0.62
54_F	58_F	0.718	0.60
83_Q	86_E	0.716	0.60
19_I	50_L	0.710	0.59
54_F	57_A	0.691	0.57
72_D	77_K	0.676	0.55
4_Q	7_N	0.676	0.55
19_I	22_A	0.661	0.54
11_K	14_L	0.656	0.53
15_S	19_I	0.655	0.53
35_Q	41_P	0.650	0.53
44_H	64_E	0.646	0.52
45_A	49_E	0.636	0.51
32_E	48_K	0.633	0.51
5_V	14_L	0.631	0.50
70_F	77_K	0.627	0.50
59_V	62_L	0.626	0.50
3_D	43_S	0.625	0.50
82_E	86_E	0.623	0.50
17_E	60_D	0.617	0.49
31_Y	54_F	0.601	0.47
70_F	73_R	0.598	0.47
28_A	52_A	0.594	0.46
84_A	89_D	0.593	0.46
64_E	67_G	0.590	0.46
2_Y	7_N	0.578	0.45
66_K	69_D	0.578	0.45
10_H	69_D	0.572	0.44
17_E	49_E	0.570	0.44
2_Y	45_A	0.566	0.43
16_H	64_E	0.552	0.42
31_Y	34_H	0.544	0.41
19_I	23_A	0.544	0.41
51_L	55_A	0.543	0.41
85_E	88_Y	0.541	0.40
22_A	26_E	0.537	0.40
73_R	86_E	0.529	0.39
5_V	13_K	0.527	0.39
70_F	78_H	0.522	0.38
37_K	40_K	0.520	0.38
12_A	65_T	0.518	0.38
15_S	71_I	0.516	0.38
35_Q	46_K	0.514	0.38
63_V	73_R	0.511	0.37
60_D	73_R	0.504	0.37
13_K	43_S	0.502	0.36
15_S	18_L	0.502	0.36
35_Q	38_N	0.500	0.36
14_L	19_I	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mraA	1	0.7582	4.1	0.932	Contact Map
3rznA	2	0.7802	3.4	0.935	Contact Map
3q23A	1	0.989	2.8	0.938	Contact Map
3kfuF	2	0.5495	2.6	0.939	Contact Map
4wj3B	2	0.5275	2.3	0.94	Contact Map
4emeA	4	0.3736	1.9	0.943	Contact Map
4k84A	1	0.7473	1.9	0.943	Contact Map
4k30A	2	0.3516	1.7	0.945	Contact Map
3ugsB	2	0.3846	1.7	0.945	Contact Map
2dxeA	5	0.5934	1.6	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.