DUF3751 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3751 - Phage tail-collar fibre protein

PFAM:	PF12571	Sequences: MSQKYYTILTNAGEAKLANAAALGTPLNITHMAVGDGNGTPPTPDETQTALVNEVYRAPINSLSVDPVNPNQIIAEAVIPEDVGGFWIREIGLFDADGDLIAVANCPETYKPLLAEGSGRTLTIRMILEVSNAAAVTLKIDPSVVLATRD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	150 (146)
Sequences:	2020 (1399)
Seq/√Len:	115.8
META:	0.535

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_E	57_R	4.474	1.00
92_G	100_L	3.913	1.00
12_A	99_D	3.580	1.00
33_A	94_F	3.035	1.00
16_K	99_D	2.948	1.00
31_H	57_R	2.870	1.00
28_N	96_A	2.847	1.00
19_N	23_L	2.831	1.00
33_A	54_E	2.614	1.00
16_K	95_D	2.348	1.00
63_L	75_A	2.345	1.00
35_G	90_E	2.207	1.00
11_N	46_E	2.030	1.00
48_Q	103_V	2.023	1.00
11_N	47_T	1.883	1.00
58_A	77_A	1.879	1.00
33_A	57_R	1.873	1.00
29_I	101_I	1.854	1.00
16_K	97_D	1.834	1.00
76_E	125_R	1.819	1.00
32_M	77_A	1.805	1.00
95_D	99_D	1.800	1.00
14_E	46_E	1.799	1.00
36_D	89_R	1.798	1.00
56_Y	77_A	1.791	1.00
36_D	53_N	1.746	1.00
60_I	75_A	1.696	1.00
60_I	63_L	1.684	1.00
72_Q	127_I	1.607	1.00
87_W	108_E	1.579	1.00
55_V	86_F	1.545	1.00
84_G	111_K	1.537	1.00
42_P	48_Q	1.536	1.00
33_A	50_A	1.521	1.00
110_Y	116_E	1.490	1.00
75_A	93_L	1.488	1.00
66_D	69_N	1.451	1.00
34_V	79_I	1.424	1.00
37_G	90_E	1.390	1.00
12_A	16_K	1.375	1.00
14_E	132_N	1.372	1.00
11_N	14_E	1.369	1.00
38_N	53_N	1.364	1.00
31_H	98_G	1.361	1.00
31_H	59_P	1.358	1.00
72_Q	129_E	1.337	1.00
91_I	126_M	1.305	1.00
9_L	14_E	1.265	0.99
91_I	104_A	1.253	0.99
56_Y	86_F	1.253	0.99
143_S	146_L	1.239	0.99
114_L	119_G	1.232	0.99
17_L	21_A	1.230	0.99
95_D	101_I	1.229	0.99
83_V	86_F	1.226	0.99
42_P	52_V	1.225	0.99
12_A	15_A	1.208	0.99
88_I	106_C	1.199	0.99
11_N	15_A	1.196	0.99
69_N	72_Q	1.165	0.99
7_T	104_A	1.156	0.99
34_V	77_A	1.152	0.99
94_F	100_L	1.107	0.98
33_A	51_L	1.087	0.98
91_I	106_C	1.086	0.98
16_K	101_I	1.084	0.98
52_V	90_E	1.078	0.98
15_A	19_N	1.068	0.98
102_A	126_M	1.057	0.98
17_L	27_L	1.055	0.98
43_T	105_N	1.028	0.98
27_L	101_I	1.023	0.97
112_P	120_R	1.015	0.97
74_I	125_R	1.009	0.97
34_V	56_Y	1.009	0.97
89_R	108_E	1.007	0.97
88_I	122_L	0.993	0.97
100_L	103_V	0.971	0.96
36_D	39_G	0.942	0.96
41_P	108_E	0.935	0.96
145_V	148_T	0.928	0.95
91_I	124_I	0.927	0.95
46_E	132_N	0.913	0.95
28_N	137_T	0.910	0.95
18_A	22_A	0.904	0.95
29_I	93_L	0.901	0.95
81_E	121_T	0.877	0.94
44_P	105_N	0.868	0.94
145_V	149_R	0.856	0.93
14_E	21_A	0.851	0.93
142_P	146_L	0.833	0.92
51_L	90_E	0.827	0.92
20_A	27_L	0.824	0.92
12_A	19_N	0.810	0.91
17_L	101_I	0.802	0.91
18_A	130_V	0.797	0.90
34_V	58_A	0.796	0.90
69_N	129_E	0.774	0.89
32_M	60_I	0.768	0.89
38_N	89_R	0.767	0.89
42_P	103_V	0.759	0.88
21_A	135_A	0.757	0.88
57_R	98_G	0.753	0.88
66_D	74_I	0.749	0.87
93_L	126_M	0.748	0.87
65_V	128_L	0.745	0.87
36_D	55_V	0.743	0.87
34_V	124_I	0.743	0.87
36_D	108_E	0.730	0.86
32_M	75_A	0.730	0.86
87_W	110_Y	0.725	0.86
39_G	111_K	0.721	0.85
130_V	133_A	0.717	0.85
79_I	82_D	0.715	0.85
139_K	142_P	0.713	0.85
30_T	96_A	0.712	0.85
67_P	71_N	0.702	0.84
61_N	76_E	0.698	0.83
143_S	148_T	0.696	0.83
50_A	54_E	0.694	0.83
35_G	52_V	0.694	0.83
109_T	120_R	0.691	0.83
141_D	144_V	0.690	0.83
8_I	45_D	0.686	0.82
23_L	139_K	0.685	0.82
57_R	94_F	0.680	0.82
9_L	17_L	0.679	0.82
144_V	147_A	0.674	0.81
62_S	76_E	0.671	0.81
18_A	73_I	0.662	0.80
64_S	74_I	0.660	0.80
130_V	136_V	0.659	0.80
56_Y	83_V	0.655	0.79
107_P	117_G	0.653	0.79
102_A	128_L	0.652	0.79
64_S	76_E	0.650	0.79
123_T	127_I	0.650	0.79
32_M	126_M	0.647	0.78
66_D	72_Q	0.642	0.78
10_T	13_G	0.639	0.78
85_G	117_G	0.637	0.77
8_I	47_T	0.632	0.77
109_T	122_L	0.626	0.76
30_T	59_P	0.625	0.76
66_D	70_P	0.624	0.76
36_D	87_W	0.624	0.76
8_I	46_E	0.624	0.76
17_L	135_A	0.622	0.76
140_I	145_V	0.620	0.75
25_T	115_A	0.620	0.75
107_P	118_S	0.619	0.75
86_F	111_K	0.613	0.75
5_Y	109_T	0.611	0.74
107_P	110_Y	0.610	0.74
29_I	128_L	0.608	0.74
104_A	126_M	0.607	0.74
14_E	71_N	0.606	0.74
110_Y	113_L	0.604	0.74
91_I	105_N	0.600	0.73
107_P	111_K	0.599	0.73
36_D	44_P	0.599	0.73
15_A	143_S	0.599	0.73
9_L	102_A	0.598	0.73
35_G	54_E	0.596	0.73
18_A	21_A	0.590	0.72
13_G	101_I	0.586	0.71
42_P	105_N	0.585	0.71
10_T	92_G	0.583	0.71
37_G	51_L	0.581	0.71
33_A	92_G	0.581	0.71
20_A	23_L	0.580	0.71
9_L	130_V	0.579	0.70
43_T	46_E	0.579	0.70
115_A	144_V	0.574	0.70
21_A	133_A	0.573	0.70
16_K	27_L	0.571	0.69
4_K	21_A	0.571	0.69
44_P	48_Q	0.569	0.69
50_A	92_G	0.569	0.69
16_K	19_N	0.568	0.69
48_Q	52_V	0.565	0.69
37_G	41_P	0.563	0.68
45_D	48_Q	0.562	0.68
21_A	26_P	0.562	0.68
118_S	122_L	0.561	0.68
20_A	80_P	0.560	0.68
109_T	117_G	0.558	0.68
31_H	54_E	0.558	0.68
123_T	145_V	0.557	0.67
21_A	101_I	0.554	0.67
8_I	48_Q	0.547	0.66
37_G	52_V	0.542	0.65
66_D	127_I	0.542	0.65
79_I	84_G	0.538	0.65
81_E	114_L	0.537	0.65
34_V	55_V	0.536	0.65
138_L	144_V	0.536	0.65
17_L	130_V	0.536	0.65
12_A	49_T	0.535	0.64
29_I	63_L	0.531	0.64
6_Y	9_L	0.529	0.64
14_E	48_Q	0.526	0.63
45_D	103_V	0.525	0.63
55_V	58_A	0.525	0.63
13_G	29_I	0.522	0.63
4_K	116_E	0.520	0.62
85_G	113_L	0.515	0.61
133_A	136_V	0.513	0.61
7_T	126_M	0.512	0.61
29_I	64_S	0.512	0.61
32_M	122_L	0.511	0.61
32_M	78_V	0.506	0.60
13_G	20_A	0.504	0.60
20_A	135_A	0.504	0.60
99_D	102_A	0.503	0.60
139_K	144_V	0.503	0.60
136_V	147_A	0.501	0.59
32_M	56_Y	0.501	0.59
16_K	20_A	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2k4qA	1	0.4933	8.6	0.93	Contact Map
2y2wA	3	0.1333	4.2	0.939	Contact Map
2kutA	1	0.58	2.7	0.945	Contact Map
2ayaA	1	0.4533	2.3	0.947	Contact Map
4ng0A	1	0.2867	2.1	0.948	Contact Map
4rgwA	1	0.88	2.1	0.948	Contact Map
1vraB	2	0.9867	2	0.948	Contact Map
3it4B	2	0.98	1.9	0.949	Contact Map
1vz6A	2	0.9467	1.7	0.951	Contact Map
2jx5A	1	0.24	1.6	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.