DUF3734 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3734 - Patatin phospholipase

PFAM:	PF12536	Sequences: IQYSSRTRSNTDRQKQIHRLRHAIRELLAKLPEELRDDPEVRELAAYGCETVMHIVHLIYRRKDYEGHSKDYEFSRASMREHWQAGYADTRRTLAHPPWLARPDPD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (104)
Sequences:	7945 (4293)
Seq/√Len:	421.0
META:	0.945

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
87_Y	91_R	3.598	1.00
26_E	40_E	2.987	1.00
30_K	40_E	2.863	1.00
84_Q	88_A	2.580	1.00
30_K	38_D	2.441	1.00
28_L	45_A	2.424	1.00
30_K	35_L	2.311	1.00
25_R	50_E	2.299	1.00
33_E	36_R	2.254	1.00
13_R	16_Q	2.249	1.00
38_D	41_V	2.092	1.00
77_A	81_E	1.843	1.00
73_E	78_S	1.776	1.00
76_R	80_R	1.748	1.00
26_E	29_A	1.658	1.00
23_A	44_L	1.640	1.00
80_R	84_Q	1.639	1.00
37_D	42_R	1.619	1.00
97_P	100_L	1.596	1.00
32_P	35_L	1.517	1.00
42_R	45_A	1.403	1.00
12_D	15_K	1.395	1.00
7_T	11_T	1.379	1.00
75_S	78_S	1.361	1.00
31_L	41_V	1.335	1.00
88_A	92_R	1.314	1.00
33_E	37_D	1.303	1.00
43_E	46_A	1.288	1.00
28_L	31_L	1.272	1.00
84_Q	87_Y	1.270	1.00
20_L	23_A	1.270	1.00
35_L	38_D	1.269	1.00
9_S	13_R	1.265	1.00
18_H	21_R	1.258	1.00
11_T	55_I	1.250	1.00
8_R	11_T	1.185	1.00
25_R	29_A	1.166	1.00
10_N	13_R	1.161	1.00
87_Y	90_T	1.147	1.00
98_P	101_A	1.147	1.00
20_L	47_Y	1.134	1.00
91_R	95_A	1.127	1.00
27_L	41_V	1.118	1.00
14_Q	53_M	1.098	1.00
36_R	45_A	1.090	1.00
19_R	43_E	1.075	1.00
60_Y	82_H	1.073	1.00
18_H	51_T	1.068	1.00
96_H	100_L	1.058	1.00
24_I	27_L	1.052	1.00
60_Y	63_K	1.050	1.00
36_R	41_V	1.041	1.00
13_R	17_I	1.040	1.00
88_A	95_A	1.020	1.00
4_S	8_R	0.997	1.00
20_L	24_I	0.989	1.00
21_R	48_G	0.969	1.00
24_I	28_L	0.969	1.00
17_I	21_R	0.966	1.00
28_L	41_V	0.962	1.00
17_I	20_L	0.962	1.00
69_S	73_E	0.939	1.00
12_D	16_Q	0.933	1.00
7_T	15_K	0.932	1.00
15_K	19_R	0.907	1.00
69_S	72_Y	0.905	1.00
66_E	82_H	0.880	1.00
31_L	36_R	0.879	1.00
23_A	43_E	0.875	1.00
31_L	35_L	0.858	1.00
11_T	57_H	0.858	1.00
40_E	43_E	0.853	1.00
26_E	43_E	0.847	1.00
92_R	95_A	0.844	1.00
41_V	45_A	0.829	1.00
65_Y	81_E	0.825	1.00
90_T	94_L	0.821	1.00
35_L	41_V	0.811	1.00
88_A	91_R	0.810	1.00
22_H	49_C	0.801	1.00
39_P	42_R	0.800	1.00
62_R	69_S	0.800	1.00
19_R	52_V	0.797	1.00
38_D	42_R	0.794	1.00
22_H	26_E	0.785	1.00
2_Q	9_S	0.777	1.00
60_Y	66_E	0.765	1.00
96_H	101_A	0.762	1.00
19_R	22_H	0.754	1.00
58_L	90_T	0.754	1.00
49_C	53_M	0.749	1.00
92_R	96_H	0.747	1.00
56_V	93_T	0.745	1.00
72_Y	82_H	0.742	1.00
89_D	92_R	0.739	1.00
28_L	32_P	0.731	1.00
67_G	79_M	0.726	1.00
26_E	30_K	0.726	1.00
28_L	48_G	0.725	1.00
42_R	46_A	0.719	1.00
4_S	9_S	0.718	1.00
6_R	66_E	0.715	1.00
101_A	104_D	0.710	1.00
93_T	96_H	0.710	1.00
22_H	50_E	0.704	1.00
54_H	99_W	0.703	1.00
52_V	102_R	0.698	1.00
18_H	22_H	0.693	1.00
63_K	81_E	0.690	1.00
43_E	47_Y	0.684	1.00
67_G	73_E	0.680	1.00
100_L	103_P	0.676	1.00
15_K	70_K	0.676	1.00
94_L	97_P	0.673	1.00
14_Q	17_I	0.673	1.00
2_Q	10_N	0.663	0.99
44_L	48_G	0.656	0.99
63_K	66_E	0.653	0.99
24_I	41_V	0.648	0.99
6_R	18_H	0.645	0.99
98_P	103_P	0.643	0.99
94_L	103_P	0.642	0.99
71_D	74_F	0.633	0.99
95_A	100_L	0.628	0.99
95_A	102_R	0.622	0.99
26_E	38_D	0.622	0.99
27_L	31_L	0.596	0.99
37_D	45_A	0.596	0.99
20_L	43_E	0.595	0.99
8_R	59_I	0.593	0.99
40_E	44_L	0.592	0.99
63_K	85_A	0.589	0.99
21_R	49_C	0.588	0.99
18_H	49_C	0.586	0.99
64_D	68_H	0.578	0.99
25_R	48_G	0.570	0.98
47_Y	50_E	0.567	0.98
4_S	7_T	0.563	0.98
22_H	25_R	0.557	0.98
25_R	47_Y	0.545	0.98
81_E	84_Q	0.544	0.98
62_R	82_H	0.540	0.98
7_T	89_D	0.539	0.98
77_A	80_R	0.538	0.98
96_H	103_P	0.538	0.98
97_P	103_P	0.537	0.98
66_E	78_S	0.537	0.98
60_Y	79_M	0.532	0.98
64_D	81_E	0.532	0.98
78_S	82_H	0.527	0.97
23_A	26_E	0.524	0.97
9_S	16_Q	0.521	0.97
63_K	68_H	0.518	0.97
62_R	66_E	0.514	0.97
83_W	89_D	0.512	0.97
36_R	39_P	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3t72q	1	0.6887	38.1	0.879	Contact Map
1ttyA	1	0.7264	32.4	0.884	Contact Map
2lfwA	1	0.8302	28.8	0.887	Contact Map
4g6dA	1	0.5377	28.3	0.887	Contact Map
3tu3B	1	0.5472	28.2	0.887	Contact Map
1s7oA	3	0.7264	26.6	0.889	Contact Map
3hugA	3	0.7264	24.3	0.891	Contact Map
2q1zA	1	0.7264	18.1	0.897	Contact Map
4nqwA	1	0.6509	17.2	0.898	Contact Map
1xsvA	2	0.7264	16.6	0.899	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.