DUF3696 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3696 - Protein of unknown function (DUF3696)

PFAM:	PF12476	Sequences: ISPEDVAIYFFERDEGGSSLEELEVESPIDEDGRISNWPEGFFDEWDKDLAEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	53 (47)
Sequences:	6462 (5390)
Seq/√Len:	786.2
META:	0.938

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_E	49_D	2.676	1.00
2_S	5_D	2.466	1.00
46_W	50_L	2.278	1.00
30_D	36_S	2.163	1.00
30_D	34_R	2.100	1.00
3_P	31_E	2.060	1.00
12_E	21_E	1.995	1.00
47_D	50_L	1.848	1.00
46_W	49_D	1.737	1.00
21_E	24_E	1.553	1.00
10_F	42_F	1.540	1.00
24_E	36_S	1.486	1.00
47_D	51_A	1.462	1.00
20_L	23_L	1.408	1.00
18_S	21_E	1.344	1.00
6_V	29_I	1.284	1.00
8_I	29_I	1.206	1.00
21_E	25_V	1.199	1.00
14_D	17_G	1.192	1.00
19_S	24_E	1.169	1.00
35_I	38_W	1.145	1.00
45_E	48_K	1.135	1.00
14_D	18_S	1.008	1.00
40_E	44_D	0.982	1.00
20_L	24_E	0.975	1.00
8_I	35_I	0.966	1.00
34_R	51_A	0.900	1.00
48_K	51_A	0.899	1.00
20_L	25_V	0.895	1.00
38_W	42_F	0.890	1.00
18_S	23_L	0.876	1.00
34_R	46_W	0.843	1.00
34_R	50_L	0.842	1.00
14_D	19_S	0.817	1.00
22_E	25_V	0.808	1.00
35_I	42_F	0.800	1.00
46_W	51_A	0.782	1.00
25_V	36_S	0.780	1.00
12_E	40_E	0.772	1.00
44_D	48_K	0.770	1.00
38_W	43_F	0.770	1.00
29_I	33_G	0.756	1.00
43_F	46_W	0.748	1.00
41_G	44_D	0.732	1.00
44_D	47_D	0.716	1.00
34_R	49_D	0.698	1.00
16_G	22_E	0.674	1.00
34_R	38_W	0.662	1.00
9_Y	43_F	0.647	1.00
14_D	20_L	0.611	1.00
19_S	22_E	0.604	1.00
7_A	22_E	0.599	1.00
35_I	46_W	0.598	1.00
10_F	41_G	0.582	1.00
37_N	40_E	0.576	1.00
39_P	42_F	0.574	1.00
12_E	19_S	0.563	1.00
14_D	48_K	0.560	1.00
2_S	31_E	0.556	1.00
18_S	25_V	0.550	1.00
11_F	50_L	0.545	1.00
41_G	45_E	0.531	1.00
36_S	40_E	0.530	1.00
10_F	35_I	0.519	1.00
11_F	44_D	0.519	1.00
19_S	23_L	0.512	1.00
38_W	49_D	0.508	1.00
12_E	39_P	0.506	1.00
34_R	37_N	0.501	1.00
41_G	46_W	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3s1sA	1	1	4.3	0.847	Contact Map
3anwA	1	0.6981	3.8	0.852	Contact Map
3gl3A	3	1	2.5	0.865	Contact Map
1bgcA	1	0.3208	2.4	0.865	Contact Map
2ygkA	2	0.6038	2.3	0.867	Contact Map
4yodA	1	0.9811	2.2	0.869	Contact Map
3or5A	1	1	2.1	0.869	Contact Map
3hdcA	2	1	2	0.872	Contact Map
2c0dA	2	1	1.9	0.873	Contact Map
3psiA	1	0	1.9	0.874	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.