DUF3694 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3694 - Kinesin protein

PFAM:	PF12473	Sequences: EYVPVEVDQRSDLDVFQLHQGLQRRIVVTLTHSSGDQLPWERVRNSPGTHVRVGPVRLLDLNADGKIPDSDSLTPDVSLGLLSEPYVEFNADGTSEVTAEASWDSSLHDSLLLNRVTPSNERVYLTLSWDVVSEPCAEPVVFRKDICVQIYSRDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	155 (147)
Sequences:	566 (365)
Seq/√Len:	30.1
META:	0.155

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_D	108_H	3.405	1.00
21_G	24_R	3.394	1.00
21_G	25_R	3.327	1.00
120_N	131_V	2.996	1.00
6_E	17_Q	2.739	1.00
16_F	148_V	2.601	1.00
5_V	59_L	2.490	0.99
125_L	146_I	2.338	0.99
104_D	114_N	2.204	0.98
19_H	112_L	2.178	0.98
105_S	108_H	2.036	0.97
38_L	127_L	2.014	0.97
114_N	117_T	2.005	0.97
138_E	142_F	1.981	0.97
125_L	148_V	1.978	0.97
85_P	133_S	1.873	0.96
60_D	63_A	1.846	0.95
110_S	117_T	1.840	0.95
85_P	88_E	1.745	0.94
25_R	28_V	1.714	0.93
55_P	58_L	1.688	0.92
4_P	21_G	1.665	0.92
59_L	122_R	1.652	0.92
89_F	92_D	1.636	0.91
79_L	82_L	1.616	0.91
23_Q	106_S	1.596	0.90
38_L	133_S	1.573	0.90
21_G	108_H	1.560	0.89
25_R	105_S	1.549	0.89
63_A	118_P	1.546	0.89
80_G	83_S	1.539	0.88
106_S	110_S	1.512	0.88
4_P	51_V	1.477	0.86
76_D	80_G	1.461	0.86
4_P	20_Q	1.458	0.86
78_S	83_S	1.455	0.85
75_P	80_G	1.449	0.85
111_L	118_P	1.448	0.85
38_L	60_D	1.417	0.84
7_V	153_R	1.388	0.83
69_D	81_L	1.360	0.81
85_P	89_F	1.319	0.79
4_P	7_V	1.319	0.79
25_R	104_D	1.298	0.78
69_D	107_L	1.274	0.77
51_V	99_A	1.269	0.76
117_T	122_R	1.265	0.76
103_W	108_H	1.226	0.74
74_T	101_A	1.216	0.73
136_C	154_D	1.204	0.73
22_L	123_V	1.202	0.72
73_L	76_D	1.195	0.72
130_D	141_V	1.187	0.71
20_Q	60_D	1.182	0.71
25_R	108_H	1.177	0.71
140_V	143_R	1.142	0.68
146_I	150_I	1.131	0.68
2_Y	117_T	1.113	0.66
135_P	142_F	1.112	0.66
32_H	35_G	1.111	0.66
80_G	84_E	1.094	0.65
76_D	128_S	1.094	0.65
11_S	14_D	1.082	0.64
139_P	145_D	1.077	0.64
19_H	79_L	1.064	0.63
25_R	106_S	1.054	0.62
105_S	114_N	1.044	0.61
2_Y	24_R	1.043	0.61
86_Y	89_F	1.042	0.61
4_P	153_R	1.039	0.61
24_R	56_V	1.034	0.61
63_A	67_I	1.032	0.60
12_D	27_V	1.028	0.60
54_G	57_R	1.022	0.60
75_P	81_L	1.021	0.60
7_V	23_Q	1.005	0.58
50_H	54_G	1.004	0.58
25_R	102_S	0.998	0.58
42_R	51_V	0.997	0.58
13_L	28_V	0.993	0.57
78_S	84_E	0.973	0.56
5_V	60_D	0.972	0.56
75_P	82_L	0.961	0.55
105_S	113_L	0.961	0.55
76_D	82_L	0.952	0.54
82_L	86_Y	0.946	0.54
11_S	88_E	0.944	0.54
97_V	133_S	0.920	0.52
72_S	77_V	0.910	0.51
38_L	100_E	0.902	0.50
30_L	35_G	0.898	0.50
84_E	92_D	0.897	0.50
19_H	42_R	0.893	0.50
16_F	128_S	0.888	0.49
13_L	38_L	0.883	0.49
20_Q	108_H	0.879	0.48
28_V	141_V	0.876	0.48
73_L	78_S	0.873	0.48
133_S	141_V	0.867	0.47
40_W	140_V	0.858	0.47
77_V	80_G	0.857	0.47
59_L	131_V	0.856	0.47
114_N	136_C	0.848	0.46
19_H	94_T	0.838	0.45
7_V	22_L	0.837	0.45
145_D	153_R	0.836	0.45
143_R	150_I	0.826	0.44
19_H	33_S	0.825	0.44
1_E	84_E	0.824	0.44
2_Y	150_I	0.817	0.44
78_S	132_V	0.806	0.43
43_V	137_A	0.803	0.42
22_L	34_S	0.802	0.42
43_V	83_S	0.801	0.42
57_R	145_D	0.799	0.42
16_F	84_E	0.797	0.42
101_A	107_L	0.796	0.42
2_Y	23_Q	0.790	0.41
74_T	83_S	0.783	0.41
91_A	117_T	0.782	0.41
106_S	109_D	0.778	0.40
108_H	115_R	0.778	0.40
131_V	149_Q	0.775	0.40
106_S	114_N	0.769	0.40
75_P	78_S	0.767	0.40
123_V	129_W	0.766	0.40
110_S	123_V	0.764	0.39
35_G	41_E	0.763	0.39
88_E	91_A	0.750	0.38
110_S	116_V	0.749	0.38
77_V	151_Y	0.743	0.38
85_P	91_A	0.738	0.37
110_S	115_R	0.732	0.37
82_L	85_P	0.731	0.37
106_S	117_T	0.730	0.37
112_L	118_P	0.728	0.37
87_V	91_A	0.728	0.37
2_Y	106_S	0.726	0.37
85_P	90_N	0.724	0.36
43_V	75_P	0.711	0.35
22_L	139_P	0.710	0.35
2_Y	104_D	0.709	0.35
2_Y	115_R	0.709	0.35
16_F	87_V	0.703	0.35
124_Y	129_W	0.698	0.35
20_Q	25_R	0.692	0.34
108_H	113_L	0.689	0.34
103_W	114_N	0.689	0.34
7_V	18_L	0.685	0.34
3_V	28_V	0.682	0.33
115_R	123_V	0.681	0.33
11_S	74_T	0.677	0.33
43_V	66_K	0.676	0.33
137_A	150_I	0.673	0.33
121_E	124_Y	0.672	0.33
26_I	67_I	0.671	0.33
1_E	15_V	0.667	0.32
20_Q	115_R	0.658	0.32
26_I	78_S	0.654	0.31
112_L	115_R	0.653	0.31
58_L	122_R	0.652	0.31
60_D	65_G	0.645	0.31
79_L	93_G	0.632	0.30
115_R	133_S	0.627	0.30
21_G	106_S	0.627	0.30
15_V	120_N	0.626	0.30
74_T	81_L	0.625	0.29
50_H	55_P	0.622	0.29
21_G	115_R	0.621	0.29
41_E	132_V	0.620	0.29
137_A	152_S	0.619	0.29
69_D	77_V	0.616	0.29
104_D	123_V	0.612	0.29
87_V	92_D	0.611	0.29
84_E	87_V	0.610	0.29
35_G	154_D	0.608	0.28
36_D	68_P	0.605	0.28
16_F	137_A	0.604	0.28
87_V	90_N	0.603	0.28
51_V	139_P	0.600	0.28
76_D	148_V	0.595	0.28
24_R	110_S	0.595	0.28
77_V	93_G	0.592	0.27
25_R	57_R	0.590	0.27
7_V	20_Q	0.590	0.27
12_D	141_V	0.589	0.27
56_V	146_I	0.586	0.27
78_S	82_L	0.586	0.27
91_A	142_F	0.580	0.27
11_S	49_T	0.580	0.27
2_Y	11_S	0.577	0.26
6_E	133_S	0.575	0.26
51_V	131_V	0.575	0.26
36_D	102_S	0.572	0.26
30_L	93_G	0.571	0.26
52_R	149_Q	0.570	0.26
12_D	147_C	0.564	0.26
43_V	76_D	0.555	0.25
74_T	78_S	0.552	0.25
40_W	153_R	0.546	0.25
22_L	77_V	0.545	0.24
7_V	16_F	0.541	0.24
99_A	102_S	0.540	0.24
19_H	102_S	0.538	0.24
120_N	137_A	0.535	0.24
25_R	53_V	0.535	0.24
12_D	150_I	0.530	0.24
140_V	150_I	0.528	0.23
13_L	43_V	0.525	0.23
7_V	19_H	0.524	0.23
66_K	109_D	0.522	0.23
70_S	118_P	0.517	0.23
31_T	131_V	0.514	0.23
21_G	153_R	0.513	0.23
29_T	33_S	0.511	0.23
7_V	108_H	0.508	0.22
56_V	150_I	0.506	0.22
133_S	140_V	0.503	0.22
37_Q	93_G	0.501	0.22
131_V	134_E	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4jcwA	2	0.3742	3.2	0.958	Contact Map
3e8vA	1	0.3484	3	0.959	Contact Map
2qngA	1	0.4	3	0.959	Contact Map
1vtze	8	0.529	1.8	0.963	Contact Map
3nrfA	3	0.3097	1.7	0.964	Contact Map
4whiA	1	0.4581	1.6	0.964	Contact Map
1s55A	3	0.3355	1.5	0.965	Contact Map
2k5lA	1	0.2258	1.5	0.965	Contact Map
2xspA	1	0.7935	1.4	0.966	Contact Map
2e9xD	1	0.3548	1.3	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.