GTP_CH_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GTP_CH_N - GTP cyclohydrolase N terminal

PFAM:	PF12471	Sequences: KHIRLTSHPGQGGKGPFPIHWGAADPAERGPVIGTVLPTNPAHRNVIGTHSGSYSVYRALAVAAGALDPDHRPDLTNTAPAVPIGPHPQWSDPGKIVSLDPWGHLVAEVFADEIAAGYDIRPTIAVTKAHIDLPEIREAIAAGRLKPDGKILLENGGDVRVTKAAIEPVWYLPGVAERFGVSESDLRRALFEQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	193 (189)
Sequences:	1685 (760)
Seq/√Len:	55.3
META:	0.81

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_G	177_E	5.803	1.00
25_D	28_E	5.060	1.00
139_A	144_R	4.202	1.00
145_L	152_L	3.697	1.00
111_A	115_A	3.412	1.00
132_D	158_D	3.085	1.00
34_G	46_V	3.035	1.00
147_P	152_L	3.004	1.00
105_L	109_V	2.994	1.00
23_A	28_E	2.928	1.00
140_I	147_P	2.909	1.00
155_N	158_D	2.593	1.00
147_P	157_G	2.558	1.00
24_A	91_S	2.400	1.00
113_E	118_Y	2.292	1.00
138_E	142_A	2.265	1.00
20_H	28_E	2.234	1.00
32_V	46_V	2.218	1.00
43_H	118_Y	2.135	1.00
182_S	185_D	2.124	1.00
112_D	116_A	2.119	1.00
91_S	102_W	2.097	1.00
188_R	192_E	2.057	1.00
106_V	114_I	2.046	1.00
27_A	113_E	2.023	1.00
92_D	95_K	1.893	1.00
97_V	174_G	1.857	0.99
23_A	102_W	1.841	0.99
132_D	137_R	1.838	0.99
13_G	16_P	1.804	0.99
113_E	116_A	1.785	0.99
83_P	105_L	1.754	0.99
36_V	49_T	1.686	0.99
40_N	43_H	1.644	0.99
131_I	164_A	1.565	0.98
22_G	92_D	1.511	0.98
35_T	73_P	1.505	0.98
149_G	154_E	1.500	0.97
63_A	71_H	1.481	0.97
158_D	162_T	1.462	0.97
36_V	41_P	1.449	0.97
51_S	71_H	1.431	0.97
61_A	179_F	1.413	0.96
152_L	159_V	1.408	0.96
114_I	118_Y	1.362	0.96
34_G	55_S	1.343	0.95
143_G	146_K	1.339	0.95
62_V	67_L	1.284	0.94
2_H	8_H	1.267	0.93
88_P	91_S	1.261	0.93
130_H	160_R	1.254	0.93
112_D	115_A	1.252	0.93
49_T	55_S	1.224	0.92
138_E	141_A	1.199	0.91
2_H	7_S	1.196	0.91
82_V	128_K	1.194	0.91
104_H	113_E	1.192	0.91
133_L	160_R	1.191	0.91
56_V	70_D	1.183	0.91
153_L	160_R	1.178	0.91
17_F	118_Y	1.170	0.90
83_P	126_V	1.154	0.90
25_D	102_W	1.153	0.90
133_L	139_A	1.131	0.89
17_F	113_E	1.131	0.89
130_H	164_A	1.115	0.88
96_I	99_L	1.112	0.88
46_V	73_P	1.106	0.88
79_A	108_E	1.102	0.87
181_V	185_D	1.100	0.87
12_G	16_P	1.088	0.87
35_T	119_D	1.080	0.86
189_A	193_Q	1.077	0.86
41_P	46_V	1.074	0.86
159_V	167_E	1.073	0.86
64_A	140_I	1.070	0.86
68_D	71_H	1.050	0.85
19_I	32_V	1.042	0.84
51_S	185_D	1.041	0.84
23_A	26_P	1.039	0.84
137_R	141_A	1.027	0.83
20_H	23_A	1.021	0.83
105_L	108_E	1.018	0.83
59_A	190_L	1.012	0.83
35_T	50_H	1.012	0.83
4_R	10_G	1.007	0.82
82_V	162_T	0.995	0.81
54_Y	129_A	0.992	0.81
50_H	64_A	0.943	0.78
106_V	109_V	0.942	0.78
16_P	43_H	0.940	0.78
167_E	175_V	0.938	0.77
81_A	104_H	0.937	0.77
99_L	124_I	0.936	0.77
132_D	155_N	0.926	0.77
146_K	152_L	0.925	0.77
104_H	118_Y	0.923	0.76
4_R	73_P	0.920	0.76
24_A	88_P	0.917	0.76
51_S	167_E	0.916	0.76
39_T	50_H	0.909	0.75
34_G	56_V	0.906	0.75
146_K	154_E	0.905	0.75
119_D	128_K	0.901	0.75
183_E	187_R	0.898	0.74
85_G	89_Q	0.890	0.74
25_D	109_V	0.886	0.73
26_P	109_V	0.882	0.73
17_F	33_I	0.882	0.73
150_K	160_R	0.880	0.73
43_H	131_I	0.880	0.73
150_K	158_D	0.866	0.72
171_Y	175_V	0.861	0.71
87_H	102_W	0.851	0.70
51_S	63_A	0.841	0.69
141_A	157_G	0.841	0.69
70_D	107_A	0.838	0.69
41_P	55_S	0.838	0.69
51_S	83_P	0.835	0.69
22_G	91_S	0.827	0.68
114_I	191_F	0.825	0.68
95_K	153_L	0.823	0.68
55_S	188_R	0.817	0.67
42_A	62_V	0.816	0.67
128_K	162_T	0.811	0.67
33_I	39_T	0.811	0.67
138_E	143_G	0.807	0.66
153_L	189_A	0.804	0.66
24_A	28_E	0.803	0.66
61_A	128_K	0.802	0.66
186_L	190_L	0.801	0.66
76_T	96_I	0.800	0.66
27_A	112_D	0.799	0.65
65_G	117_G	0.797	0.65
102_W	109_V	0.797	0.65
80_P	104_H	0.794	0.65
67_L	80_P	0.790	0.65
12_G	17_F	0.788	0.64
35_T	42_A	0.782	0.64
145_L	154_E	0.779	0.63
67_L	76_T	0.777	0.63
2_H	14_K	0.777	0.63
137_R	157_G	0.765	0.62
49_T	71_H	0.765	0.62
187_R	190_L	0.756	0.61
74_D	98_S	0.756	0.61
133_L	151_I	0.746	0.60
36_V	39_T	0.745	0.60
34_G	131_I	0.741	0.60
49_T	87_H	0.737	0.59
4_R	193_Q	0.733	0.59
11_Q	15_G	0.731	0.59
20_H	56_V	0.730	0.58
99_L	166_I	0.728	0.58
16_P	33_I	0.724	0.58
83_P	108_E	0.722	0.58
111_A	116_A	0.719	0.57
87_H	151_I	0.718	0.57
126_V	159_V	0.717	0.57
73_P	87_H	0.710	0.56
62_V	157_G	0.708	0.56
118_Y	167_E	0.704	0.56
153_L	158_D	0.698	0.55
183_E	186_L	0.690	0.54
4_R	136_I	0.685	0.54
110_F	171_Y	0.684	0.54
11_Q	14_K	0.683	0.53
12_G	23_A	0.682	0.53
27_A	110_F	0.681	0.53
147_P	150_K	0.680	0.53
95_K	146_K	0.677	0.53
68_D	128_K	0.674	0.52
177_E	182_S	0.667	0.52
61_A	67_L	0.665	0.51
36_V	193_Q	0.663	0.51
82_V	132_D	0.663	0.51
22_G	94_G	0.661	0.51
113_E	120_I	0.651	0.50
133_L	138_E	0.649	0.50
8_H	36_V	0.645	0.49
185_D	189_A	0.639	0.49
64_A	159_V	0.638	0.49
7_S	16_P	0.637	0.48
49_T	128_K	0.635	0.48
17_F	26_P	0.635	0.48
84_I	126_V	0.632	0.48
34_G	50_H	0.629	0.48
46_V	158_D	0.629	0.48
137_R	142_A	0.629	0.48
7_S	19_I	0.627	0.47
16_P	167_E	0.626	0.47
171_Y	174_G	0.624	0.47
49_T	179_F	0.624	0.47
132_D	152_L	0.623	0.47
81_A	181_V	0.620	0.47
138_E	144_R	0.620	0.47
53_S	114_I	0.618	0.46
131_I	134_P	0.617	0.46
43_H	73_P	0.613	0.46
150_K	153_L	0.611	0.46
44_R	117_G	0.610	0.46
4_R	16_P	0.609	0.45
99_L	167_E	0.608	0.45
32_V	72_R	0.606	0.45
44_R	60_L	0.603	0.45
60_L	186_L	0.603	0.45
85_G	121_R	0.599	0.44
86_P	102_W	0.599	0.44
120_I	177_E	0.596	0.44
33_I	118_Y	0.596	0.44
81_A	167_E	0.593	0.44
166_I	180_G	0.593	0.44
171_Y	177_E	0.592	0.44
138_E	153_L	0.591	0.44
13_G	18_P	0.588	0.43
50_H	123_T	0.588	0.43
27_A	109_V	0.587	0.43
35_T	121_R	0.586	0.43
136_I	159_V	0.582	0.43
75_L	107_A	0.582	0.43
11_Q	53_S	0.581	0.42
79_A	133_L	0.581	0.42
61_A	193_Q	0.580	0.42
104_H	114_I	0.575	0.42
104_H	147_P	0.574	0.42
33_I	42_A	0.573	0.42
61_A	131_I	0.573	0.42
133_L	153_L	0.572	0.42
9_P	61_A	0.570	0.41
55_S	72_R	0.569	0.41
18_P	166_I	0.568	0.41
79_A	111_A	0.567	0.41
60_L	71_H	0.565	0.41
7_S	49_T	0.565	0.41
56_V	104_H	0.565	0.41
70_D	175_V	0.564	0.41
64_A	99_L	0.561	0.40
58_R	62_V	0.561	0.40
62_V	113_E	0.560	0.40
4_R	65_G	0.559	0.40
62_V	118_Y	0.558	0.40
49_T	70_D	0.556	0.40
134_P	137_R	0.555	0.40
154_E	177_E	0.552	0.39
187_R	191_F	0.552	0.39
58_R	117_G	0.549	0.39
115_A	138_E	0.549	0.39
2_H	55_S	0.547	0.39
133_L	136_I	0.543	0.39
112_D	155_N	0.543	0.39
73_P	121_R	0.542	0.38
24_A	155_N	0.542	0.38
88_P	95_K	0.541	0.38
140_I	152_L	0.539	0.38
131_I	159_V	0.538	0.38
147_P	155_N	0.536	0.38
79_A	83_P	0.534	0.38
76_T	79_A	0.534	0.38
19_I	46_V	0.533	0.38
17_F	63_A	0.533	0.38
16_P	34_G	0.532	0.37
77_N	116_A	0.529	0.37
89_Q	121_R	0.525	0.37
24_A	72_R	0.524	0.37
10_G	14_K	0.524	0.37
64_A	181_V	0.522	0.36
153_L	159_V	0.522	0.36
79_A	123_T	0.519	0.36
19_I	95_K	0.518	0.36
69_P	193_Q	0.517	0.36
123_T	134_P	0.514	0.36
29_R	32_V	0.513	0.36
118_Y	146_K	0.512	0.35
104_H	160_R	0.512	0.35
64_A	121_R	0.512	0.35
81_A	105_L	0.511	0.35
145_L	155_N	0.511	0.35
98_S	179_F	0.507	0.35
27_A	77_N	0.506	0.35
175_V	179_F	0.506	0.35
16_P	118_Y	0.505	0.35
130_H	153_L	0.504	0.35
22_G	74_D	0.502	0.34
20_H	32_V	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ra5A	2	0.0052	77.4	0.952	Contact Map
2ek5A	4	0.2591	63.8	0.957	Contact Map
3ihuA	1	0.2487	60.9	0.958	Contact Map
4tv7A	2	0.3057	58.5	0.958	Contact Map
3eetA	2	0.2746	56.5	0.959	Contact Map
2hs5A	1	0.2539	56.3	0.959	Contact Map
3neuA	2	0.2953	54.8	0.959	Contact Map
4u0wA	2	0.3057	50	0.96	Contact Map
1u8bA	1	0.5389	49.7	0.96	Contact Map
2b0lA	4	0.3316	43.5	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.