DUF3671 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3671 - Protein of unknown function

PFAM:	PF12420	Sequences: KKGLKKLDCYCEKKIFDKIDKIYKLAEKMKNDKKSFKKKILKKYGIRLILFSLIPLLGLIFPILNKDTWEIIEYLNYIFFFILIIIVLLVIIYILIKVIKYE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	102 (102)
Sequences:	585 (413)
Seq/√Len:	40.9
META:	0.009

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_K	17_D	4.923	1.00
93_Y	97_K	3.243	1.00
18_K	21_K	3.162	1.00
80_F	83_L	2.906	1.00
20_D	23_Y	2.509	1.00
2_K	5_K	2.144	0.99
93_Y	101_Y	2.023	0.99
79_F	83_L	1.956	0.99
95_L	98_V	1.941	0.99
3_G	7_L	1.920	0.99
81_F	84_I	1.864	0.98
89_L	94_I	1.724	0.97
99_I	102_E	1.715	0.97
17_D	28_K	1.709	0.97
88_L	96_I	1.597	0.96
58_G	64_L	1.529	0.94
24_K	27_E	1.524	0.94
68_T	71_I	1.517	0.94
97_K	101_Y	1.503	0.94
55_P	62_P	1.465	0.93
66_K	70_E	1.415	0.92
36_F	41_L	1.382	0.91
69_W	88_L	1.364	0.90
11_C	14_K	1.344	0.90
12_E	16_F	1.344	0.90
65_N	82_I	1.336	0.89
65_N	68_T	1.301	0.88
67_D	70_E	1.295	0.88
37_K	45_G	1.275	0.87
5_K	24_K	1.271	0.87
6_K	10_Y	1.259	0.86
35_S	39_K	1.228	0.85
72_I	76_N	1.220	0.84
78_I	84_I	1.216	0.84
83_L	87_V	1.206	0.84
38_K	74_Y	1.187	0.83
63_I	75_L	1.181	0.82
61_F	73_E	1.166	0.82
57_L	62_P	1.125	0.79
6_K	9_C	1.122	0.79
21_K	36_F	1.113	0.78
51_F	62_P	1.110	0.78
82_I	90_V	1.089	0.77
28_K	35_S	1.078	0.76
68_T	95_L	1.077	0.76
59_L	77_Y	1.065	0.75
51_F	55_P	1.062	0.75
27_E	34_K	1.057	0.75
73_E	77_Y	1.037	0.73
72_I	77_Y	1.037	0.73
25_L	48_L	1.017	0.72
67_D	82_I	1.016	0.72
37_K	94_I	0.995	0.70
19_I	50_L	0.990	0.70
48_L	54_I	0.990	0.70
48_L	81_F	0.956	0.67
22_I	38_K	0.949	0.66
16_F	20_D	0.944	0.66
8_D	24_K	0.941	0.66
20_D	56_L	0.941	0.66
19_I	74_Y	0.928	0.65
1_K	7_L	0.927	0.65
8_D	21_K	0.896	0.62
46_I	50_L	0.894	0.62
5_K	21_K	0.885	0.61
53_L	62_P	0.885	0.61
46_I	55_P	0.881	0.61
49_I	63_I	0.881	0.61
5_K	30_K	0.878	0.60
33_K	61_F	0.878	0.60
15_I	20_D	0.878	0.60
56_L	67_D	0.870	0.60
37_K	41_L	0.864	0.59
4_L	30_K	0.856	0.58
52_S	91_I	0.855	0.58
38_K	99_I	0.851	0.58
74_Y	77_Y	0.844	0.57
82_I	85_I	0.837	0.57
20_D	47_R	0.797	0.53
67_D	71_I	0.789	0.52
93_Y	100_K	0.778	0.51
68_T	77_Y	0.777	0.51
81_F	86_I	0.775	0.51
30_K	36_F	0.773	0.51
69_W	72_I	0.772	0.51
66_K	69_W	0.772	0.51
72_I	82_I	0.771	0.51
28_K	91_I	0.768	0.50
62_P	73_E	0.765	0.50
34_K	60_I	0.758	0.49
76_N	84_I	0.754	0.49
17_D	23_Y	0.754	0.49
71_I	82_I	0.751	0.49
61_F	83_L	0.746	0.48
10_Y	86_I	0.745	0.48
51_F	58_G	0.739	0.48
32_D	35_S	0.726	0.46
8_D	97_K	0.725	0.46
22_I	31_N	0.718	0.46
26_A	40_I	0.708	0.45
7_L	63_I	0.700	0.44
32_D	75_L	0.698	0.44
63_I	80_F	0.681	0.42
13_K	23_Y	0.681	0.42
2_K	44_Y	0.681	0.42
18_K	60_I	0.669	0.41
18_K	32_D	0.664	0.41
69_W	73_E	0.661	0.41
74_Y	78_I	0.661	0.41
42_K	56_L	0.659	0.40
2_K	9_C	0.659	0.40
19_I	27_E	0.654	0.40
7_L	11_C	0.651	0.40
3_G	55_P	0.649	0.39
78_I	82_I	0.649	0.39
29_M	90_V	0.642	0.39
24_K	80_F	0.642	0.39
45_G	56_L	0.639	0.39
59_L	83_L	0.634	0.38
84_I	91_I	0.632	0.38
23_Y	30_K	0.621	0.37
80_F	84_I	0.620	0.37
47_R	58_G	0.620	0.37
58_G	62_P	0.618	0.37
33_K	38_K	0.616	0.37
26_A	93_Y	0.615	0.37
48_L	95_L	0.613	0.36
21_K	41_L	0.609	0.36
61_F	75_L	0.599	0.35
29_M	91_I	0.594	0.35
3_G	9_C	0.589	0.34
21_K	24_K	0.585	0.34
71_I	86_I	0.584	0.34
19_I	71_I	0.580	0.34
30_K	50_L	0.579	0.33
21_K	44_Y	0.574	0.33
45_G	94_I	0.572	0.33
31_N	59_L	0.571	0.33
8_D	32_D	0.570	0.33
91_I	98_V	0.567	0.32
67_D	73_E	0.566	0.32
14_K	44_Y	0.565	0.32
45_G	53_L	0.553	0.31
84_I	94_I	0.545	0.31
24_K	91_I	0.533	0.30
19_I	24_K	0.529	0.29
27_E	86_I	0.528	0.29
68_T	72_I	0.521	0.29
5_K	86_I	0.520	0.29
9_C	53_L	0.505	0.28
15_I	34_K	0.504	0.28
74_Y	88_L	0.503	0.28
31_N	98_V	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fftB	1	0.4118	2.8	0.928	Contact Map
3k4tA	3	0.2059	1.6	0.937	Contact Map
4ng0A	1	0.3235	1.4	0.939	Contact Map
2l6wA	2	0.3824	1.3	0.94	Contact Map
1jb0I	1	0.3725	1.2	0.942	Contact Map
2m8rA	1	0.6078	1.1	0.943	Contact Map
4bgnA	3	0.549	1.1	0.943	Contact Map
4ev6A	3	0.902	1	0.944	Contact Map
4xk8I	1	0.2843	1	0.944	Contact Map
3j39b	1	0.2549	1	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.