Choline_sulf_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Choline_sulf_C - Choline sulfatase enzyme C terminal

PFAM:	PF12411	Sequences: EDVLASQRRRRLVYAALRQGRYTPWDYQPLRDASRRYVRNHMDLNDLEARARF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	53 (52)
Sequences:	2817 (1287)
Seq/√Len:	178.4
META:	0.922

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_R	36_R	4.308	1.00
28_Q	33_A	2.886	1.00
14_Y	18_R	2.024	1.00
45_N	48_E	1.975	1.00
27_Y	30_L	1.806	1.00
18_R	22_Y	1.748	1.00
8_R	11_R	1.719	1.00
35_R	41_H	1.701	1.00
29_P	33_A	1.620	1.00
24_P	34_S	1.610	1.00
46_D	50_R	1.604	1.00
44_L	48_E	1.524	1.00
32_D	35_R	1.368	1.00
38_V	48_E	1.337	1.00
16_A	20_G	1.221	1.00
6_S	9_R	1.214	1.00
2_D	5_A	1.199	1.00
5_A	9_R	1.195	1.00
38_V	47_L	1.105	1.00
9_R	51_A	1.077	1.00
43_D	46_D	1.059	1.00
13_V	16_A	1.054	1.00
22_Y	40_N	1.036	1.00
15_A	19_Q	1.034	1.00
38_V	45_N	1.030	0.99
40_N	44_L	1.013	0.99
46_D	49_A	0.968	0.99
28_Q	31_R	0.966	0.99
4_L	8_R	0.950	0.99
45_N	49_A	0.948	0.99
17_L	20_G	0.945	0.99
38_V	41_H	0.944	0.99
17_L	23_T	0.942	0.99
14_Y	38_V	0.940	0.99
12_L	16_A	0.922	0.99
38_V	42_M	0.914	0.99
44_L	51_A	0.908	0.99
50_R	53_F	0.875	0.98
44_L	47_L	0.867	0.98
47_L	50_R	0.834	0.98
14_Y	40_N	0.829	0.98
48_E	51_A	0.827	0.98
42_M	47_L	0.820	0.97
42_M	50_R	0.799	0.97
11_R	15_A	0.791	0.97
4_L	11_R	0.790	0.97
19_Q	23_T	0.770	0.96
13_V	17_L	0.768	0.96
9_R	48_E	0.736	0.95
17_L	24_P	0.719	0.95
27_Y	31_R	0.719	0.95
47_L	53_F	0.715	0.94
49_A	53_F	0.715	0.94
18_R	21_R	0.709	0.94
33_A	36_R	0.689	0.93
23_T	30_L	0.677	0.93
8_R	12_L	0.663	0.92
43_D	48_E	0.635	0.90
15_A	21_R	0.628	0.90
19_Q	22_Y	0.624	0.89
47_L	51_A	0.611	0.88
29_P	39_R	0.600	0.87
41_H	44_L	0.594	0.87
48_E	52_R	0.594	0.87
33_A	37_Y	0.578	0.85
43_D	47_L	0.572	0.85
4_L	12_L	0.570	0.85
35_R	42_M	0.567	0.84
42_M	45_N	0.555	0.83
28_Q	32_D	0.547	0.82
18_R	42_M	0.543	0.82
10_R	25_W	0.537	0.81
28_Q	37_Y	0.534	0.81
30_L	35_R	0.529	0.80
6_S	25_W	0.528	0.80
26_D	33_A	0.519	0.79
19_Q	36_R	0.509	0.77
31_R	38_V	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1kkxA	1	0.2075	4.7	0.876	Contact Map
4hu4A	1	0.7736	4.6	0.876	Contact Map
4hjfA	1	0.8302	4.5	0.876	Contact Map
4rnhA	2	0.8679	4.4	0.877	Contact Map
3rx6A	2	0.8113	4.1	0.879	Contact Map
3hv8A	1	0.7358	3.9	0.881	Contact Map
2r6oA	2	0.7736	3.6	0.882	Contact Map
2basA	2	0.7358	3.1	0.886	Contact Map
3pjxA	1	0.8302	3.1	0.886	Contact Map
4fojA	1	0.8302	3.1	0.886	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0039 seconds.