P5-ATPase - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

P5-ATPase - P5-type ATPase cation transporter

PFAM:	PF12409	Sequences: EDDEMEIAGYRTSRWRLALYLAGCILTLGLLLLLFYWKPRWRVKATCKPCPLKEADWVLIEDEFGEYFVKKVRTISYGRPLSTVFPPEPENGDSSSIANANDEDNDPELLKLRYFDYRYIRYVWN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	125 (125)
Sequences:	908 (627)
Seq/√Len:	56.1
META:	0.162

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_D	66_E	4.341	1.00
23_G	31_L	4.202	1.00
47_C	57_W	3.163	1.00
10_Y	16_R	2.547	1.00
43_V	57_W	2.425	1.00
88_E	91_N	2.337	1.00
55_A	113_R	2.175	1.00
22_A	26_L	2.080	1.00
12_T	17_L	2.071	1.00
116_D	121_R	2.034	1.00
33_L	41_W	2.019	1.00
87_P	90_E	1.991	1.00
77_Y	83_T	1.966	1.00
9_G	52_L	1.932	1.00
33_L	37_W	1.894	1.00
52_L	72_V	1.888	1.00
35_F	39_P	1.876	1.00
104_D	108_E	1.849	0.99
20_Y	35_F	1.819	0.99
20_Y	118_R	1.803	0.99
94_S	97_I	1.781	0.99
20_Y	24_C	1.753	0.99
24_C	32_L	1.716	0.99
43_V	47_C	1.712	0.99
22_A	25_I	1.580	0.98
20_Y	23_G	1.547	0.98
104_D	107_P	1.536	0.98
92_G	96_S	1.510	0.98
72_V	113_R	1.505	0.98
89_P	92_G	1.498	0.98
79_R	83_T	1.458	0.97
11_R	54_E	1.384	0.96
33_L	39_P	1.366	0.96
27_T	31_L	1.365	0.96
84_V	109_L	1.290	0.94
36_Y	124_W	1.279	0.94
17_L	30_L	1.277	0.94
52_L	57_W	1.269	0.94
92_G	98_A	1.220	0.92
22_A	73_R	1.220	0.92
10_Y	32_L	1.170	0.91
36_Y	119_Y	1.167	0.91
98_A	102_D	1.160	0.90
88_E	92_G	1.150	0.90
70_K	117_Y	1.142	0.90
50_C	55_A	1.142	0.90
94_S	98_A	1.133	0.89
62_D	114_Y	1.131	0.89
92_G	103_E	1.128	0.89
22_A	60_I	1.110	0.88
96_S	100_A	1.102	0.88
43_V	64_F	1.095	0.88
18_A	21_L	1.094	0.87
13_S	17_L	1.057	0.86
13_S	48_K	1.048	0.85
97_I	103_E	1.021	0.84
45_A	57_W	1.009	0.83
30_L	34_L	1.008	0.83
20_Y	42_R	0.990	0.82
26_L	112_L	0.986	0.81
22_A	102_D	0.986	0.81
88_E	94_S	0.976	0.81
7_I	16_R	0.970	0.80
20_Y	45_A	0.967	0.80
13_S	16_R	0.952	0.79
89_P	93_D	0.952	0.79
113_R	124_W	0.947	0.79
86_P	89_P	0.946	0.79
31_L	35_F	0.942	0.78
24_C	118_R	0.920	0.77
96_S	103_E	0.918	0.77
96_S	99_N	0.909	0.76
32_L	119_Y	0.908	0.76
35_F	69_V	0.908	0.76
32_L	42_R	0.906	0.76
13_S	41_W	0.902	0.75
87_P	91_N	0.900	0.75
27_T	95_S	0.897	0.75
119_Y	124_W	0.887	0.74
11_R	56_D	0.882	0.74
60_I	70_K	0.881	0.73
34_L	38_K	0.881	0.73
86_P	103_E	0.875	0.73
97_I	101_N	0.872	0.73
36_Y	61_E	0.869	0.72
3_D	36_Y	0.864	0.72
21_L	24_C	0.859	0.72
77_Y	82_S	0.857	0.71
94_S	101_N	0.856	0.71
74_T	111_K	0.839	0.70
88_E	93_D	0.837	0.70
89_P	94_S	0.837	0.70
17_L	21_L	0.831	0.69
11_R	120_I	0.828	0.69
28_L	117_Y	0.820	0.68
92_G	97_I	0.816	0.68
35_F	118_R	0.805	0.67
11_R	50_C	0.802	0.66
100_A	103_E	0.801	0.66
35_F	119_Y	0.795	0.66
2_D	6_E	0.785	0.65
14_R	54_E	0.783	0.64
42_R	46_T	0.777	0.64
46_T	124_W	0.776	0.64
68_F	73_R	0.776	0.64
34_L	51_P	0.771	0.63
43_V	65_G	0.769	0.63
9_G	37_W	0.766	0.63
55_A	123_V	0.760	0.62
9_G	39_P	0.756	0.62
73_R	114_Y	0.751	0.61
14_R	18_A	0.750	0.61
6_E	31_L	0.747	0.61
74_T	80_P	0.744	0.60
67_Y	77_Y	0.736	0.60
93_D	96_S	0.734	0.59
87_P	97_I	0.732	0.59
26_L	104_D	0.727	0.59
96_S	102_D	0.719	0.58
36_Y	47_C	0.705	0.56
114_Y	121_R	0.705	0.56
67_Y	117_Y	0.697	0.55
59_L	119_Y	0.692	0.55
80_P	123_V	0.689	0.55
97_I	100_A	0.680	0.54
28_L	31_L	0.679	0.54
95_S	100_A	0.671	0.53
14_R	110_L	0.666	0.52
80_P	84_V	0.662	0.52
90_E	94_S	0.661	0.52
2_D	122_Y	0.650	0.50
93_D	100_A	0.645	0.50
6_E	39_P	0.645	0.50
21_L	31_L	0.638	0.49
112_L	121_R	0.635	0.49
109_L	112_L	0.633	0.49
38_K	44_K	0.629	0.48
102_D	109_L	0.628	0.48
5_M	59_L	0.628	0.48
55_A	115_F	0.623	0.47
30_L	36_Y	0.623	0.47
72_V	111_K	0.620	0.47
40_R	65_G	0.618	0.47
35_F	116_D	0.618	0.47
37_W	55_A	0.617	0.47
43_V	116_D	0.611	0.46
99_N	103_E	0.607	0.46
18_A	25_I	0.607	0.46
46_T	115_F	0.595	0.44
99_N	102_D	0.595	0.44
1_E	52_L	0.595	0.44
33_L	36_Y	0.594	0.44
72_V	91_N	0.592	0.44
19_L	27_T	0.590	0.44
63_E	70_K	0.590	0.44
8_A	61_E	0.585	0.43
21_L	60_I	0.584	0.43
16_R	53_K	0.582	0.43
44_K	110_L	0.580	0.43
48_K	112_L	0.578	0.43
41_W	46_T	0.577	0.43
4_E	55_A	0.567	0.41
6_E	61_E	0.557	0.40
36_Y	41_W	0.557	0.40
3_D	47_C	0.555	0.40
4_E	59_L	0.549	0.40
88_E	96_S	0.544	0.39
74_T	113_R	0.542	0.39
26_L	31_L	0.542	0.39
32_L	124_W	0.541	0.39
81_L	101_N	0.536	0.38
97_I	102_D	0.535	0.38
43_V	118_R	0.534	0.38
87_P	93_D	0.531	0.38
84_V	87_P	0.528	0.37
11_R	55_A	0.528	0.37
16_R	35_F	0.525	0.37
35_F	123_V	0.524	0.37
20_Y	119_Y	0.519	0.37
22_A	28_L	0.518	0.36
91_N	95_S	0.517	0.36
7_I	58_V	0.515	0.36
61_E	112_L	0.514	0.36
57_W	69_V	0.511	0.36
33_L	52_L	0.505	0.35
78_G	85_F	0.504	0.35
86_P	90_E	0.502	0.35
34_L	89_P	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1oedE	1	0.28	3.8	0.936	Contact Map
1oedC	1	0.28	3.8	0.936	Contact Map
2hw4A	1	0.312	3.4	0.938	Contact Map
2nmmA	3	0.312	3.2	0.939	Contact Map
2j5lA	1	0	3.2	0.939	Contact Map
2a65A	2	0.56	3	0.939	Contact Map
2xgrA	1	0.464	2.9	0.94	Contact Map
2kogA	1	0.32	2.2	0.944	Contact Map
3rn5A	1	0.28	1.8	0.946	Contact Map
4xtrG	1	0.176	1.8	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.