U3snoRNP10 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

U3snoRNP10 - U3 small nucleolar RNA-associated protein 10

PFAM:	PF12397	Sequences: ILLRLLPVLLEGLKSSKVPDLQAASYMILSVLASKATLSDKVLDALMEAIAKGWTEETLRSGLLCLIVLAQTQEQLPKKVLKALLKVPDLVELLLELSKEYDVDKLLLGLLPSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	114 (112)
Sequences:	600 (473)
Seq/√Len:	44.7
META:	0.25

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_I	106_L	4.946	1.00
12_G	25_S	4.485	1.00
33_A	69_L	4.281	1.00
106_L	110_L	3.569	1.00
29_L	46_L	3.060	1.00
27_M	35_K	2.568	1.00
25_S	28_I	2.288	1.00
12_G	21_L	2.278	1.00
54_W	62_G	2.138	1.00
97_L	100_E	2.129	1.00
47_M	66_L	1.971	0.99
107_L	112_P	1.964	0.99
56_E	91_V	1.825	0.99
76_L	81_L	1.810	0.99
89_D	93_L	1.779	0.98
85_L	90_L	1.659	0.97
59_L	89_D	1.626	0.97
46_L	50_I	1.524	0.96
105_K	112_P	1.504	0.95
4_R	42_V	1.464	0.95
23_A	26_Y	1.440	0.94
64_L	69_L	1.420	0.94
77_P	80_V	1.412	0.93
51_A	80_V	1.389	0.93
13_L	29_L	1.341	0.91
94_L	106_L	1.336	0.91
14_K	24_A	1.327	0.91
8_V	26_Y	1.320	0.91
2_L	23_A	1.319	0.91
90_L	108_L	1.300	0.90
9_L	25_S	1.286	0.90
76_L	90_L	1.250	0.88
3_L	25_S	1.233	0.88
24_A	49_A	1.218	0.87
76_L	91_V	1.169	0.85
9_L	99_K	1.140	0.83
63_L	89_D	1.137	0.83
33_A	68_V	1.133	0.83
21_L	31_V	1.127	0.82
95_L	105_K	1.112	0.82
67_I	99_K	1.108	0.81
74_E	98_S	1.094	0.80
24_A	27_M	1.091	0.80
5_L	38_L	1.082	0.80
106_L	109_G	1.071	0.79
58_T	81_L	1.049	0.78
2_L	42_V	1.043	0.77
68_V	72_T	1.041	0.77
22_Q	26_Y	1.032	0.76
24_A	87_V	1.004	0.74
69_L	91_V	0.995	0.74
68_V	75_Q	0.972	0.72
50_I	69_L	0.963	0.71
42_V	45_A	0.954	0.71
26_Y	53_G	0.953	0.70
29_L	63_L	0.949	0.70
84_L	108_L	0.942	0.70
28_I	85_L	0.930	0.69
91_V	95_L	0.920	0.68
9_L	17_K	0.918	0.68
2_L	74_E	0.917	0.67
8_V	42_V	0.916	0.67
31_V	61_S	0.910	0.67
56_E	104_D	0.897	0.66
23_A	58_T	0.893	0.65
104_D	109_G	0.886	0.65
4_R	54_W	0.884	0.65
22_Q	40_D	0.879	0.64
9_L	32_L	0.876	0.64
63_L	93_L	0.869	0.63
10_L	13_L	0.866	0.63
27_M	31_V	0.863	0.63
4_R	8_V	0.860	0.62
36_A	53_G	0.849	0.61
63_L	70_A	0.844	0.61
97_L	101_Y	0.833	0.60
29_L	36_A	0.827	0.59
44_D	90_L	0.815	0.58
63_L	94_L	0.814	0.58
50_I	60_R	0.810	0.58
15_S	26_Y	0.808	0.58
5_L	50_I	0.805	0.57
9_L	86_K	0.801	0.57
72_T	105_K	0.798	0.57
29_L	107_L	0.785	0.55
3_L	10_L	0.780	0.55
85_L	112_P	0.776	0.55
31_V	34_S	0.768	0.54
26_Y	57_E	0.766	0.54
47_M	50_I	0.760	0.53
82_K	86_K	0.757	0.53
2_L	11_E	0.752	0.52
16_S	36_A	0.745	0.52
45_A	59_L	0.743	0.51
6_L	20_D	0.735	0.51
34_S	63_L	0.734	0.50
17_K	37_T	0.730	0.50
65_C	68_V	0.728	0.50
28_I	36_A	0.725	0.50
40_D	81_L	0.720	0.49
48_E	76_L	0.720	0.49
56_E	60_R	0.714	0.49
64_L	68_V	0.712	0.48
85_L	110_L	0.696	0.47
61_S	88_P	0.691	0.46
4_R	69_L	0.689	0.46
2_L	79_K	0.680	0.45
92_E	99_K	0.678	0.45
106_L	111_L	0.676	0.45
6_L	35_K	0.676	0.45
40_D	73_Q	0.674	0.45
27_M	71_Q	0.673	0.45
27_M	109_G	0.671	0.44
28_I	34_S	0.665	0.44
4_R	38_L	0.665	0.44
56_E	59_L	0.664	0.44
36_A	47_M	0.660	0.43
76_L	83_A	0.656	0.43
47_M	70_A	0.655	0.43
54_W	67_I	0.649	0.42
78_K	107_L	0.648	0.42
19_P	47_M	0.644	0.42
23_A	30_S	0.643	0.42
22_Q	46_L	0.642	0.42
94_L	100_E	0.635	0.41
16_S	54_W	0.631	0.41
18_V	39_S	0.630	0.41
2_L	104_D	0.620	0.40
13_L	25_S	0.618	0.39
48_E	62_G	0.615	0.39
63_L	109_G	0.615	0.39
57_E	94_L	0.614	0.39
67_I	70_A	0.612	0.39
21_L	24_A	0.602	0.38
84_L	105_K	0.596	0.37
47_M	80_V	0.594	0.37
30_S	34_S	0.592	0.37
70_A	103_V	0.591	0.37
5_L	80_V	0.590	0.37
9_L	15_S	0.587	0.37
23_A	27_M	0.574	0.35
24_A	53_G	0.573	0.35
29_L	52_K	0.568	0.35
38_L	49_A	0.567	0.35
32_L	75_Q	0.567	0.35
62_G	108_L	0.562	0.34
99_K	109_G	0.561	0.34
33_A	60_R	0.558	0.34
14_K	69_L	0.558	0.34
45_A	98_S	0.557	0.34
3_L	110_L	0.555	0.34
64_L	97_L	0.555	0.34
26_Y	73_Q	0.553	0.34
90_L	96_E	0.553	0.34
6_L	42_V	0.553	0.34
51_A	54_W	0.551	0.33
14_K	52_K	0.546	0.33
13_L	24_A	0.541	0.33
5_L	12_G	0.540	0.32
8_V	12_G	0.534	0.32
45_A	49_A	0.532	0.32
49_A	112_P	0.513	0.30
5_L	37_T	0.511	0.30
30_S	102_D	0.509	0.30
2_L	80_V	0.507	0.30
28_I	109_G	0.504	0.29
98_S	103_V	0.503	0.29
18_V	76_L	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3opbA	2	0.9912	74.8	0.82	Contact Map
1qgrA	1	0.9825	72.7	0.824	Contact Map
4qmiA	1	0.9912	71.6	0.825	Contact Map
1ibrB	1	0.4561	65.9	0.832	Contact Map
3w3wA	1	0.9474	64.3	0.833	Contact Map
4g3aA	1	0.9825	63.9	0.834	Contact Map
2qk2A	1	0.9912	62.8	0.835	Contact Map
3vwaA	1	0.9561	61.4	0.837	Contact Map
4fddA	1	0.9912	58.8	0.839	Contact Map
2bptA	1	0.9912	58.1	0.84	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.