DUF3658 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3658 - Protein of unknown function

PFAM:	PF12395	Sequences: LKLARPLTLSEFEVDPDEWKKLCEENAPLRILEGGKLVSVPEDFYDAEILKFITAEWQKAARVIGEVLGKMKIKTGDAFLLWRLKELIAAGKLEVQGDLKAMRDYE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (100)
Sequences:	2418 (1702)
Seq/√Len:	170.2
META:	0.804

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_A	39_S	3.219	1.00
86_E	89_A	2.986	1.00
28_P	42_E	2.726	1.00
88_I	95_V	2.668	1.00
62_R	66_E	2.575	1.00
53_I	63_V	2.552	1.00
49_I	80_L	2.550	1.00
5_R	11_E	2.457	1.00
22_L	39_S	2.343	1.00
50_L	92_K	2.229	1.00
60_A	84_L	2.174	1.00
95_V	99_L	1.983	1.00
25_E	39_S	1.959	1.00
53_I	93_L	1.927	1.00
49_I	67_V	1.884	1.00
65_G	69_G	1.871	1.00
52_F	67_V	1.870	1.00
31_I	40_V	1.864	1.00
54_T	58_Q	1.839	1.00
64_I	68_L	1.779	1.00
52_F	66_E	1.720	1.00
29_L	79_F	1.650	1.00
50_L	93_L	1.621	1.00
26_N	39_S	1.603	1.00
67_V	80_L	1.574	1.00
31_I	45_Y	1.553	1.00
33_E	36_K	1.480	1.00
18_E	21_K	1.459	1.00
58_Q	63_V	1.432	1.00
57_W	96_Q	1.374	1.00
42_E	79_F	1.356	1.00
20_K	24_E	1.269	1.00
64_I	81_L	1.260	1.00
33_E	38_V	1.254	1.00
63_V	67_V	1.243	1.00
31_I	44_F	1.234	1.00
8_T	11_E	1.218	1.00
7_L	15_D	1.139	1.00
21_K	25_E	1.130	1.00
15_D	18_E	1.107	1.00
52_F	70_K	1.101	1.00
22_L	25_E	1.096	1.00
86_E	90_A	1.090	1.00
46_D	83_R	1.087	1.00
48_E	71_M	1.067	1.00
49_I	84_L	1.049	0.99
68_L	77_D	1.043	0.99
40_V	44_F	1.017	0.99
48_E	51_K	1.017	0.99
28_P	79_F	0.982	0.99
82_W	86_E	0.979	0.99
44_F	73_I	0.955	0.99
42_E	86_E	0.945	0.99
88_I	93_L	0.942	0.99
7_L	12_F	0.937	0.99
60_A	81_L	0.922	0.99
62_R	65_G	0.920	0.99
6_P	12_F	0.910	0.98
68_L	74_K	0.901	0.98
10_S	13_E	0.898	0.98
81_L	85_K	0.896	0.98
31_I	73_I	0.894	0.98
32_L	37_L	0.893	0.98
85_K	89_A	0.878	0.98
12_F	16_P	0.870	0.98
47_A	51_K	0.846	0.98
18_E	36_K	0.837	0.97
59_K	62_R	0.820	0.97
3_L	6_P	0.805	0.97
29_L	40_V	0.778	0.96
18_E	79_F	0.775	0.96
20_K	23_C	0.766	0.96
4_A	84_L	0.758	0.95
57_W	81_L	0.756	0.95
64_I	84_L	0.755	0.95
12_F	17_D	0.753	0.95
75_T	80_L	0.751	0.95
87_L	92_K	0.727	0.94
48_E	67_V	0.726	0.94
60_A	64_I	0.722	0.94
50_L	87_L	0.713	0.94
29_L	44_F	0.698	0.93
57_W	97_G	0.697	0.93
85_K	99_L	0.696	0.93
46_D	49_I	0.682	0.92
65_G	68_L	0.672	0.91
54_T	63_V	0.657	0.91
4_A	7_L	0.651	0.90
30_R	39_S	0.650	0.90
13_E	17_D	0.649	0.90
62_R	68_L	0.646	0.90
61_A	65_G	0.646	0.90
9_L	14_V	0.644	0.90
63_V	84_L	0.643	0.90
60_A	85_K	0.641	0.89
5_R	8_T	0.640	0.89
47_A	50_L	0.640	0.89
89_A	99_L	0.636	0.89
19_W	45_Y	0.634	0.89
28_P	82_W	0.626	0.88
87_L	93_L	0.623	0.88
73_I	84_L	0.620	0.88
47_A	72_K	0.618	0.88
64_I	67_V	0.615	0.87
27_A	41_P	0.615	0.87
45_Y	79_F	0.614	0.87
26_N	58_Q	0.613	0.87
83_R	86_E	0.611	0.87
57_W	82_W	0.611	0.87
19_W	79_F	0.601	0.86
67_V	71_M	0.600	0.86
15_D	34_G	0.599	0.86
66_E	69_G	0.595	0.86
13_E	16_P	0.592	0.85
50_L	55_A	0.587	0.85
19_W	95_V	0.582	0.84
71_M	81_L	0.579	0.84
53_I	87_L	0.579	0.84
8_T	13_E	0.571	0.83
82_W	85_K	0.568	0.83
63_V	93_L	0.563	0.82
12_F	23_C	0.560	0.82
14_V	17_D	0.560	0.82
62_R	70_K	0.549	0.81
60_A	68_L	0.546	0.80
73_I	77_D	0.546	0.80
40_V	47_A	0.545	0.80
6_P	55_A	0.542	0.80
11_E	15_D	0.541	0.80
43_D	99_L	0.536	0.79
19_W	31_I	0.535	0.79
17_D	20_K	0.535	0.79
81_L	88_I	0.534	0.79
16_P	71_M	0.531	0.79
9_L	16_P	0.530	0.79
22_L	26_N	0.527	0.78
24_E	51_K	0.524	0.78
24_E	65_G	0.523	0.78
6_P	9_L	0.522	0.77
77_D	81_L	0.522	0.77
29_L	65_G	0.518	0.77
37_L	83_R	0.517	0.77
60_A	88_I	0.516	0.77
16_P	20_K	0.515	0.77
61_A	68_L	0.509	0.76
43_D	87_L	0.504	0.75
29_L	75_T	0.501	0.75
89_A	98_D	0.501	0.75
84_L	93_L	0.501	0.75
57_W	63_V	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1w7pD	1	0.9811	74.7	0.847	Contact Map
1u5tB	1	0.9906	43.2	0.875	Contact Map
3lvtA	2	0.6698	38	0.879	Contact Map
2hyeC	1	1	35.1	0.881	Contact Map
2gqqA	6	0.6038	34.2	0.882	Contact Map
1hsjA	2	0.9528	34	0.882	Contact Map
3dplC	1	1	33.7	0.882	Contact Map
2p5vA	5	0.6038	32.2	0.883	Contact Map
4ch7A	1	0.5472	30.8	0.885	Contact Map
3i4pA	5	0.566	28.7	0.886	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.