DNAJ_related - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DNAJ_related - DNA-J related protein

PFAM:	PF12339	Sequences: NPLLDPLLELLRAHPAGISEYELIKALQEQGYGLFPELDLSDPLALFRTHFLLFNALYQLQDQLWEEGWGHLQISPLDIRLLPSSYQAGSAALAEDDPLRDYYLDWSNLEETDEEDVERLLDSFWQRY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	128 (127)
Sequences:	828 (665)
Seq/√Len:	59.0
META:	0.653

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
112_T	116_D	5.349	1.00
20_E	50_H	4.585	1.00
62_D	100_R	3.428	1.00
24_I	53_L	3.211	1.00
65_W	71_H	3.129	1.00
24_I	49_T	3.095	1.00
106_W	109_L	3.046	1.00
44_L	117_V	2.920	1.00
113_D	116_D	2.755	1.00
61_Q	100_R	2.677	1.00
55_N	106_W	2.584	1.00
8_L	64_L	2.196	1.00
44_L	48_R	2.169	1.00
117_V	120_L	2.144	1.00
28_Q	49_T	2.133	1.00
8_L	12_R	1.987	1.00
47_F	112_T	1.950	1.00
54_F	102_Y	1.904	1.00
54_F	77_L	1.828	1.00
14_H	17_G	1.813	0.99
93_L	97_D	1.603	0.99
114_E	118_E	1.554	0.98
43_P	118_E	1.518	0.98
102_Y	112_T	1.513	0.98
14_H	18_I	1.484	0.98
19_S	22_E	1.467	0.98
18_I	22_E	1.466	0.98
11_L	15_P	1.433	0.97
73_Q	82_L	1.365	0.96
42_D	114_E	1.361	0.96
64_L	81_L	1.301	0.95
41_S	114_E	1.259	0.94
40_L	117_V	1.242	0.94
35_F	55_N	1.229	0.94
10_L	26_A	1.203	0.93
112_T	117_V	1.193	0.92
20_E	24_I	1.192	0.92
61_Q	106_W	1.182	0.92
56_A	106_W	1.173	0.92
50_H	54_F	1.149	0.91
49_T	54_F	1.149	0.91
86_Y	89_G	1.142	0.91
28_Q	31_G	1.137	0.91
17_G	80_R	1.057	0.87
66_E	88_A	1.056	0.87
120_L	123_S	1.054	0.87
45_A	49_T	1.054	0.87
12_R	64_L	1.042	0.86
42_D	49_T	1.038	0.86
9_E	16_A	1.033	0.86
2_P	55_N	1.017	0.85
17_G	76_P	0.995	0.84
74_I	104_L	0.986	0.83
26_A	29_E	0.985	0.83
50_H	103_Y	0.980	0.83
24_I	40_L	0.977	0.82
51_F	104_L	0.960	0.81
54_F	75_S	0.959	0.81
4_L	63_Q	0.955	0.81
32_Y	76_P	0.952	0.81
76_P	79_I	0.952	0.81
18_I	121_L	0.945	0.80
96_D	101_D	0.944	0.80
108_N	111_E	0.916	0.78
24_I	28_Q	0.913	0.78
105_D	108_N	0.907	0.78
117_V	121_L	0.898	0.77
21_Y	77_L	0.897	0.77
25_K	28_Q	0.892	0.76
12_R	17_G	0.892	0.76
10_L	18_I	0.880	0.75
7_L	59_Q	0.869	0.74
47_F	121_L	0.868	0.74
73_Q	80_R	0.858	0.73
2_P	54_F	0.855	0.73
17_G	53_L	0.844	0.72
55_N	120_L	0.844	0.72
63_Q	67_E	0.840	0.72
6_P	12_R	0.835	0.71
4_L	113_D	0.820	0.70
107_S	110_E	0.819	0.70
40_L	49_T	0.814	0.70
42_D	45_A	0.810	0.69
3_L	36_P	0.799	0.68
105_D	110_E	0.791	0.67
74_I	77_L	0.790	0.67
19_S	58_Y	0.788	0.67
80_R	83_P	0.774	0.66
31_G	34_L	0.767	0.65
87_Q	91_A	0.765	0.65
44_L	112_T	0.765	0.65
19_S	33_G	0.765	0.65
51_F	74_I	0.763	0.64
56_A	59_Q	0.761	0.64
18_I	26_A	0.760	0.64
38_L	41_S	0.759	0.64
6_P	10_L	0.745	0.63
7_L	56_A	0.745	0.63
13_A	89_G	0.745	0.63
5_D	48_R	0.744	0.63
20_E	35_F	0.743	0.62
73_Q	100_R	0.741	0.62
33_G	95_E	0.737	0.62
10_L	13_A	0.736	0.62
107_S	114_E	0.730	0.61
64_L	100_R	0.711	0.59
61_Q	71_H	0.709	0.59
54_F	76_P	0.705	0.58
53_L	56_A	0.702	0.58
91_A	97_D	0.701	0.58
96_D	122_D	0.698	0.58
53_L	76_P	0.698	0.58
44_L	47_F	0.695	0.57
29_E	42_D	0.689	0.57
40_L	97_D	0.688	0.57
10_L	107_S	0.683	0.56
7_L	14_H	0.682	0.56
24_I	44_L	0.681	0.56
44_L	120_L	0.681	0.56
84_S	101_D	0.681	0.56
7_L	38_L	0.680	0.56
21_Y	25_K	0.676	0.55
35_F	49_T	0.673	0.55
88_A	126_Q	0.672	0.55
87_Q	122_D	0.671	0.55
51_F	102_Y	0.667	0.54
14_H	26_A	0.665	0.54
46_L	52_L	0.662	0.54
67_E	107_S	0.658	0.53
54_F	79_I	0.649	0.52
21_Y	120_L	0.645	0.52
102_Y	121_L	0.644	0.52
18_I	73_Q	0.642	0.51
21_Y	48_R	0.637	0.51
26_A	87_Q	0.629	0.50
35_F	53_L	0.618	0.49
10_L	14_H	0.615	0.48
19_S	53_L	0.613	0.48
113_D	119_R	0.613	0.48
64_L	70_G	0.613	0.48
118_E	122_D	0.612	0.48
11_L	81_L	0.610	0.48
76_P	93_L	0.608	0.48
4_L	7_L	0.605	0.47
116_D	119_R	0.603	0.47
102_Y	108_N	0.596	0.46
87_Q	94_A	0.595	0.46
55_N	64_L	0.594	0.46
12_R	69_W	0.591	0.46
94_A	101_D	0.588	0.45
26_A	30_Q	0.585	0.45
4_L	10_L	0.579	0.44
35_F	50_H	0.577	0.44
117_V	123_S	0.576	0.44
99_L	120_L	0.569	0.43
18_I	50_H	0.569	0.43
68_G	71_H	0.566	0.43
9_E	30_Q	0.564	0.43
108_N	125_W	0.561	0.42
19_S	24_I	0.560	0.42
87_Q	90_S	0.559	0.42
59_Q	108_N	0.559	0.42
13_A	23_L	0.554	0.42
68_G	90_S	0.553	0.42
9_E	13_A	0.542	0.40
5_D	8_L	0.542	0.40
19_S	73_Q	0.542	0.40
51_F	108_N	0.541	0.40
109_L	113_D	0.538	0.40
16_A	80_R	0.534	0.40
23_L	30_Q	0.534	0.40
104_L	112_T	0.533	0.39
12_R	16_A	0.532	0.39
19_S	75_S	0.530	0.39
27_L	52_L	0.530	0.39
51_F	125_W	0.529	0.39
116_D	120_L	0.527	0.39
11_L	128_Y	0.523	0.38
24_I	50_H	0.519	0.38
5_D	68_G	0.517	0.38
115_E	119_R	0.514	0.37
70_G	75_S	0.510	0.37
54_F	106_W	0.508	0.37
52_L	106_W	0.508	0.37
20_E	103_Y	0.505	0.37
2_P	5_D	0.504	0.36
86_Y	90_S	0.503	0.36
53_L	75_S	0.502	0.36
21_Y	76_P	0.502	0.36
4_L	59_Q	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3odnA	1	0.7266	23.3	0.922	Contact Map
2gaiA	1	0.875	22	0.923	Contact Map
4ywtA	1	0.8438	20.8	0.924	Contact Map
2qwoB	1	0.25	15.6	0.928	Contact Map
1mw9X	1	0.875	12.7	0.931	Contact Map
3ag7A	1	0.2891	10.7	0.933	Contact Map
4cgyA	1	0.8828	9.9	0.934	Contact Map
1gkuB	1	0.875	6.5	0.94	Contact Map
1t92A	2	0.3906	6.2	0.94	Contact Map
2d4yA	1	0.3906	6.1	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.