DUF3634 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3634 - Protein of unknown function (DUF3634)

PFAM:	PF12321	Sequences: LYVILVAVALVLWLVARARELFVVRVRDGRVRVVRGRVPPAFLADLRDVARRPPVRGTIRGVRRGGGARLVFSGDIPEGQQQRLRNVFPHSGLRAKGGKKSR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	102 (90)
Sequences:	693 (546)
Seq/√Len:	57.5
META:	0.788

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_V	31_V	3.413	1.00
13_W	17_R	3.201	1.00
57_G	76_I	2.687	1.00
22_F	61_G	2.655	1.00
72_F	81_Q	2.571	1.00
42_F	46_L	2.199	1.00
53_P	80_Q	2.179	1.00
26_V	50_A	2.098	1.00
26_V	57_G	2.042	1.00
82_Q	86_N	1.986	1.00
61_G	68_A	1.973	1.00
52_R	83_R	1.957	1.00
46_L	84_L	1.868	1.00
7_A	11_V	1.812	0.99
50_A	55_V	1.767	0.99
23_V	58_T	1.568	0.98
22_F	42_F	1.564	0.98
40_P	44_A	1.558	0.98
64_R	69_R	1.533	0.98
70_L	88_F	1.532	0.98
20_E	60_R	1.463	0.97
25_R	32_R	1.394	0.97
70_L	84_L	1.372	0.96
49_V	87_V	1.366	0.96
3_V	7_A	1.349	0.96
20_E	42_F	1.346	0.96
15_V	18_A	1.339	0.96
16_A	19_R	1.331	0.95
13_W	16_A	1.312	0.95
38_V	42_F	1.311	0.95
53_P	83_R	1.297	0.95
45_D	87_V	1.291	0.95
12_L	16_A	1.242	0.93
61_G	70_L	1.238	0.93
71_V	76_I	1.201	0.92
61_G	88_F	1.193	0.92
57_G	72_F	1.182	0.92
80_Q	87_V	1.176	0.91
82_Q	85_R	1.170	0.91
13_W	18_A	1.151	0.91
89_P	92_G	1.075	0.87
10_L	14_L	1.075	0.87
9_A	16_A	1.074	0.87
81_Q	88_F	1.070	0.87
31_V	46_L	1.061	0.87
83_R	86_N	1.045	0.86
11_V	14_L	1.042	0.86
23_V	48_D	1.021	0.84
22_F	70_L	1.010	0.84
48_D	87_V	1.008	0.84
24_V	48_D	0.972	0.81
12_L	51_R	0.933	0.79
20_E	23_V	0.900	0.76
77_P	88_F	0.895	0.76
55_V	76_I	0.883	0.75
11_V	15_V	0.879	0.74
39_P	42_F	0.874	0.74
12_L	19_R	0.867	0.73
3_V	12_L	0.852	0.72
20_E	35_R	0.838	0.71
54_P	84_L	0.827	0.70
77_P	80_Q	0.807	0.68
27_R	32_R	0.807	0.68
59_I	72_F	0.800	0.67
14_L	17_R	0.781	0.65
24_V	38_V	0.768	0.64
14_L	91_S	0.765	0.64
35_R	60_R	0.765	0.64
7_A	28_D	0.755	0.63
45_D	74_G	0.754	0.63
24_V	46_L	0.750	0.62
57_G	74_G	0.749	0.62
26_V	60_R	0.739	0.61
12_L	17_R	0.732	0.60
41_A	54_P	0.717	0.59
43_L	72_F	0.717	0.59
62_V	71_V	0.716	0.59
22_F	38_V	0.712	0.58
11_V	56_R	0.706	0.57
12_L	15_V	0.693	0.56
49_V	80_Q	0.692	0.56
81_Q	84_L	0.681	0.55
41_A	46_L	0.677	0.54
77_P	81_Q	0.676	0.54
8_V	32_R	0.675	0.54
59_I	75_D	0.669	0.53
9_A	19_R	0.668	0.53
26_V	74_G	0.668	0.53
78_E	89_P	0.667	0.53
63_R	67_G	0.666	0.53
53_P	78_E	0.657	0.52
48_D	52_R	0.655	0.52
6_V	83_R	0.654	0.52
67_G	88_F	0.643	0.51
11_V	16_A	0.640	0.50
3_V	56_R	0.635	0.50
33_V	68_A	0.633	0.50
36_G	57_G	0.632	0.49
8_V	19_R	0.632	0.49
5_L	76_I	0.620	0.48
38_V	44_A	0.619	0.48
38_V	46_L	0.618	0.48
68_A	74_G	0.617	0.48
30_R	51_R	0.609	0.47
59_I	89_P	0.608	0.47
68_A	90_H	0.604	0.46
12_L	45_D	0.603	0.46
55_V	63_R	0.600	0.46
4_I	7_A	0.596	0.45
61_G	72_F	0.595	0.45
23_V	57_G	0.585	0.44
12_L	46_L	0.582	0.44
34_V	65_G	0.581	0.44
23_V	56_R	0.577	0.43
74_G	78_E	0.572	0.43
6_V	10_L	0.567	0.42
20_E	39_P	0.561	0.42
24_V	34_V	0.555	0.41
23_V	42_F	0.550	0.41
67_G	78_E	0.545	0.40
25_R	77_P	0.545	0.40
24_V	43_L	0.534	0.39
15_V	19_R	0.530	0.38
59_I	73_S	0.529	0.38
8_V	35_R	0.526	0.38
80_Q	83_R	0.525	0.38
7_A	16_A	0.520	0.37
38_V	43_L	0.518	0.37
47_R	75_D	0.517	0.37
4_I	16_A	0.517	0.37
3_V	65_G	0.514	0.37
42_F	88_F	0.513	0.37
75_D	90_H	0.507	0.36
34_V	87_V	0.502	0.36
7_A	13_W	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1n6jG	1	0.2549	18.3	0.907	Contact Map
3thtA	3	0.9216	16	0.91	Contact Map
3j1rA	5	0.1667	11.1	0.916	Contact Map
1qpzA	2	0.5098	11.1	0.916	Contact Map
3jvdA	2	0.0196	8.6	0.92	Contact Map
3or1B	2	0.8824	8.2	0.92	Contact Map
3vthA	1	0.7647	8	0.921	Contact Map
3dbiA	2	0.0392	7.5	0.922	Contact Map
2hsgA	1	0.5098	7.2	0.923	Contact Map
4g9iA	1	0.7157	6.8	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.