DUF3617 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3617 - Protein of unknown function (DUF3617)

PFAM:	PF12276	Sequences: MKRLLLAALLALAAAAAAAAAAPNIKPGLWEITTTMEQEQMPGMPPEQRAQMEAMMAGPPQTSKQCLTPEDADKPMAPLFAGADGDCTVTDVKRSGNTVTWDMVCGGGGGTGTGEAEGTFTGDSAYTGTMTMTGTGGGQPMTMTMTITGKRLGADCG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	157 (145)
Sequences:	10057 (8223)
Seq/√Len:	682.9
META:	0.943

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_L	64_K	3.559	1.00
69_P	73_D	3.130	1.00
91_D	102_D	2.944	1.00
31_E	150_K	2.806	1.00
151_R	154_A	2.759	1.00
122_G	125_A	2.719	1.00
31_E	64_K	2.713	1.00
102_D	113_T	2.664	1.00
131_T	144_T	2.555	1.00
31_E	62_T	2.470	1.00
102_D	115_E	2.420	1.00
35_T	146_T	2.091	1.00
128_G	147_I	2.075	1.00
100_T	117_E	2.057	1.00
26_K	151_R	2.001	1.00
26_K	123_D	1.938	1.00
121_T	125_A	1.866	1.00
131_T	142_T	1.845	1.00
26_K	124_S	1.838	1.00
33_T	62_T	1.801	1.00
90_T	102_D	1.790	1.00
98_T	119_T	1.762	1.00
45_P	48_Q	1.681	1.00
129_T	146_T	1.630	1.00
27_P	69_P	1.597	1.00
129_T	144_T	1.562	1.00
94_R	99_V	1.558	1.00
90_T	104_V	1.536	1.00
32_I	149_G	1.521	1.00
31_E	152_L	1.510	1.00
15_A	18_A	1.500	1.00
33_T	148_T	1.496	1.00
101_W	116_A	1.477	1.00
70_E	73_D	1.454	1.00
100_T	115_E	1.450	1.00
93_K	100_T	1.449	1.00
64_K	152_L	1.442	1.00
106_G	109_G	1.436	1.00
133_T	142_T	1.434	1.00
75_P	78_P	1.415	1.00
37_E	144_T	1.387	1.00
69_P	72_A	1.381	1.00
18_A	21_A	1.379	1.00
74_K	77_A	1.362	1.00
67_L	72_A	1.283	1.00
35_T	60_P	1.274	1.00
104_V	113_T	1.260	1.00
68_T	71_D	1.252	1.00
29_L	152_L	1.247	1.00
74_K	78_P	1.207	1.00
89_V	103_M	1.195	1.00
10_L	14_A	1.193	1.00
39_E	42_P	1.187	1.00
98_T	117_E	1.181	1.00
127_T	148_T	1.137	1.00
27_P	72_A	1.131	1.00
92_V	99_V	1.115	1.00
91_D	100_T	1.104	1.00
14_A	17_A	1.085	1.00
8_A	11_A	1.085	1.00
65_Q	71_D	1.077	1.00
35_T	148_T	1.077	1.00
36_M	145_M	1.073	1.00
39_E	43_G	1.067	1.00
77_A	80_F	1.059	1.00
38_Q	42_P	1.052	1.00
103_M	114_G	1.045	1.00
25_I	67_L	1.043	1.00
15_A	19_A	1.028	1.00
68_T	72_A	1.027	1.00
125_A	148_T	1.021	1.00
120_F	125_A	1.020	1.00
16_A	19_A	1.013	1.00
121_T	124_S	1.010	1.00
78_P	81_A	1.010	1.00
32_I	65_Q	1.004	1.00
121_T	127_T	1.003	1.00
133_T	140_P	0.996	1.00
76_M	79_L	0.991	1.00
6_L	9_L	0.982	1.00
101_W	114_G	0.977	1.00
104_V	111_T	0.962	1.00
110_G	114_G	0.961	1.00
17_A	21_A	0.950	1.00
32_I	147_I	0.949	1.00
10_L	13_A	0.948	1.00
7_A	10_L	0.942	1.00
112_G	116_A	0.918	1.00
106_G	111_T	0.917	1.00
120_F	124_S	0.911	1.00
127_T	146_T	0.905	1.00
37_E	146_T	0.903	1.00
14_A	19_A	0.887	1.00
70_E	74_K	0.878	1.00
135_T	140_P	0.878	1.00
14_A	18_A	0.871	1.00
89_V	92_V	0.863	1.00
76_M	80_F	0.859	1.00
88_T	104_V	0.852	1.00
34_T	145_M	0.832	1.00
26_K	154_A	0.829	1.00
12_L	15_A	0.829	1.00
32_I	63_S	0.825	1.00
9_L	13_A	0.818	1.00
44_M	48_Q	0.804	1.00
33_T	60_P	0.800	1.00
6_L	10_L	0.799	1.00
72_A	76_M	0.792	1.00
17_A	20_A	0.785	1.00
12_L	16_A	0.785	1.00
94_R	97_N	0.785	1.00
115_E	131_T	0.779	1.00
75_P	82_G	0.776	1.00
118_G	122_G	0.776	1.00
134_G	141_M	0.766	1.00
128_G	132_M	0.759	1.00
107_G	110_G	0.758	1.00
72_A	75_P	0.758	1.00
119_T	122_G	0.756	1.00
77_A	81_A	0.752	1.00
15_A	20_A	0.751	1.00
99_V	120_F	0.749	1.00
130_M	147_I	0.743	1.00
14_A	20_A	0.741	1.00
78_P	82_G	0.739	1.00
13_A	17_A	0.737	1.00
125_A	149_G	0.733	1.00
16_A	21_A	0.727	1.00
32_I	126_Y	0.724	1.00
126_Y	135_T	0.715	1.00
95_S	98_T	0.709	1.00
11_A	15_A	0.708	1.00
34_T	63_S	0.706	1.00
126_Y	149_G	0.704	1.00
8_A	12_L	0.702	1.00
5_L	9_L	0.702	1.00
136_G	139_Q	0.701	1.00
117_E	129_T	0.696	1.00
38_Q	41_M	0.695	1.00
9_L	12_L	0.685	1.00
40_Q	43_G	0.683	1.00
33_T	150_K	0.681	1.00
74_K	80_F	0.680	1.00
126_Y	130_M	0.678	1.00
7_A	11_A	0.678	1.00
15_A	21_A	0.675	1.00
79_L	82_G	0.673	1.00
153_G	156_C	0.671	1.00
16_A	20_A	0.663	1.00
137_G	141_M	0.663	1.00
115_E	129_T	0.654	1.00
13_A	20_A	0.652	1.00
89_V	101_W	0.651	1.00
134_G	140_P	0.650	1.00
112_G	132_M	0.647	1.00
87_C	105_C	0.646	1.00
30_W	124_S	0.644	1.00
118_G	124_S	0.641	1.00
13_A	19_A	0.641	1.00
5_L	8_A	0.637	1.00
36_M	143_M	0.632	1.00
67_L	71_D	0.629	1.00
95_S	100_T	0.629	1.00
25_I	28_G	0.625	1.00
135_T	138_G	0.623	1.00
126_Y	134_G	0.623	1.00
27_P	151_R	0.623	1.00
41_M	44_M	0.622	1.00
118_G	123_D	0.620	1.00
97_N	119_T	0.615	1.00
86_D	107_G	0.612	1.00
74_K	79_L	0.612	1.00
42_P	45_P	0.611	1.00
68_T	73_D	0.608	1.00
116_A	128_G	0.599	1.00
48_Q	55_M	0.598	1.00
30_W	149_G	0.597	1.00
108_G	112_G	0.596	1.00
25_I	65_Q	0.591	1.00
41_M	45_P	0.589	1.00
128_G	134_G	0.578	1.00
92_V	102_D	0.577	1.00
118_G	147_I	0.575	1.00
6_L	11_A	0.570	1.00
119_T	127_T	0.561	1.00
133_T	138_G	0.558	1.00
94_R	98_T	0.555	1.00
22_A	25_I	0.554	1.00
130_M	145_M	0.553	1.00
107_G	112_G	0.551	1.00
91_D	96_G	0.545	1.00
92_V	101_W	0.543	1.00
75_P	81_A	0.542	1.00
10_L	16_A	0.540	1.00
97_N	121_T	0.538	1.00
34_T	61_Q	0.537	1.00
34_T	147_I	0.537	1.00
134_G	138_G	0.536	1.00
12_L	20_A	0.534	1.00
13_A	18_A	0.531	1.00
12_L	17_A	0.530	1.00
113_T	131_T	0.527	1.00
14_A	21_A	0.527	1.00
8_A	17_A	0.525	1.00
120_F	123_D	0.524	1.00
124_S	150_K	0.522	1.00
37_E	42_P	0.521	0.99
126_Y	129_T	0.518	0.99
6_L	12_L	0.513	0.99
8_A	15_A	0.510	0.99
103_M	132_M	0.510	0.99
98_T	115_E	0.509	0.99
13_A	16_A	0.509	0.99
25_I	30_W	0.509	0.99
44_M	56_M	0.507	0.99
113_T	133_T	0.503	0.99
93_K	102_D	0.501	0.99
109_G	112_G	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zbiC	1	0.1783	65.5	0.86	Contact Map
4jrbA	1	0.3503	4.2	0.924	Contact Map
3gb3A	2	0.3376	3.9	0.925	Contact Map
1y0gA	2	0.7643	3.7	0.926	Contact Map
4pj0O	1	0.7452	3.6	0.927	Contact Map
2qzuA	2	0.6497	2.9	0.93	Contact Map
4rh7A	1	0	2.7	0.931	Contact Map
3ai5A	1	0.3376	2.4	0.933	Contact Map
3ai4A	1	0.3439	2.4	0.933	Contact Map
1tzsX	1	0.0318	2.4	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.