PCIF1_WW - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PCIF1_WW - Phosphorylated CTD interacting factor 1 WW domain

PFAM:	PF12237	Sequences: KLEQLYRYSCNDDPKEEAFLERVFCLLLRYQTLGGGGGQQAALPPSVFDVLRKKFGVTFECFASPLNCYLPRYCSAFPDTDKYFGSLGSFFDFKPTSGSFEANPPFVEELMEAMVDHIEELLEAAEEANEPLSFVVIVPAWRDTEALKRLEKSPFLRKHLVLPAGEHGYRDG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	172 (157)
Sequences:	524 (474)
Seq/√Len:	37.8
META:	0.752

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_F	23_V	4.764	1.00
103_N	106_F	4.728	1.00
102_A	114_M	3.746	1.00
99_S	133_S	3.611	1.00
29_R	79_D	3.513	1.00
65_P	81_D	3.066	1.00
67_N	103_N	2.850	1.00
111_M	138_V	2.502	1.00
163_P	166_E	2.431	1.00
111_M	146_A	2.299	1.00
48_F	101_E	2.266	0.99
114_M	118_I	2.160	0.99
64_S	67_N	2.072	0.99
117_H	121_L	2.048	0.99
97_S	130_E	2.045	0.99
114_M	136_V	2.029	0.99
102_A	118_I	1.992	0.99
111_M	115_V	1.991	0.99
79_D	86_S	1.991	0.99
26_L	66_L	1.984	0.99
111_M	141_W	1.944	0.98
74_C	93_F	1.940	0.98
48_F	134_F	1.874	0.98
75_S	86_S	1.806	0.97
38_G	103_N	1.701	0.96
41_A	107_V	1.687	0.96
78_P	82_K	1.663	0.96
57_V	99_S	1.660	0.96
27_L	66_L	1.660	0.96
22_R	83_Y	1.656	0.96
101_E	137_I	1.634	0.95
62_F	91_F	1.626	0.95
51_L	135_V	1.533	0.93
67_N	106_F	1.523	0.93
61_C	90_F	1.514	0.93
33_L	42_A	1.486	0.92
59_F	72_R	1.469	0.92
59_F	87_L	1.467	0.92
22_R	80_T	1.466	0.92
49_D	69_Y	1.440	0.91
90_F	118_I	1.427	0.90
40_Q	64_S	1.413	0.90
90_F	134_F	1.410	0.90
88_G	105_P	1.402	0.90
59_F	74_C	1.295	0.86
115_V	146_A	1.279	0.85
67_N	141_W	1.270	0.84
20_L	23_V	1.269	0.84
74_C	87_L	1.266	0.84
79_D	88_G	1.249	0.83
90_F	105_P	1.239	0.83
72_R	87_L	1.224	0.82
43_L	48_F	1.199	0.81
103_N	141_W	1.195	0.81
38_G	106_F	1.194	0.81
49_D	53_K	1.166	0.79
122_L	134_F	1.156	0.78
57_V	133_S	1.149	0.78
95_P	117_H	1.091	0.74
95_P	121_L	1.081	0.73
66_L	158_K	1.061	0.72
100_F	134_F	1.054	0.72
161_V	166_E	1.049	0.71
61_C	100_F	1.037	0.70
98_G	134_F	1.020	0.69
40_Q	67_N	1.011	0.68
119_E	122_L	1.007	0.68
101_E	106_F	1.007	0.68
86_S	89_S	1.000	0.67
137_I	169_Y	0.997	0.67
119_E	123_E	0.986	0.66
67_N	104_P	0.986	0.66
156_L	170_R	0.981	0.66
164_A	168_G	0.973	0.65
136_V	146_A	0.971	0.65
80_T	131_P	0.960	0.64
98_G	132_L	0.950	0.63
60_E	103_N	0.947	0.63
63_A	75_S	0.935	0.62
60_E	67_N	0.931	0.62
19_F	27_L	0.929	0.62
39_Q	107_V	0.924	0.61
99_S	135_V	0.920	0.61
151_E	154_P	0.918	0.61
108_E	141_W	0.911	0.60
33_L	106_F	0.910	0.60
156_L	163_P	0.908	0.60
101_E	108_E	0.902	0.59
148_K	152_K	0.901	0.59
48_F	76_A	0.891	0.58
146_A	150_L	0.868	0.56
106_F	141_W	0.868	0.56
119_E	149_R	0.866	0.56
105_P	110_L	0.861	0.56
18_A	22_R	0.858	0.56
19_F	68_C	0.856	0.55
26_L	80_T	0.844	0.54
43_L	70_L	0.834	0.53
152_K	166_E	0.832	0.53
94_K	117_H	0.830	0.53
154_P	163_P	0.825	0.53
152_K	161_V	0.824	0.53
34_G	137_I	0.808	0.51
106_F	114_M	0.805	0.51
80_T	86_S	0.799	0.50
84_F	98_G	0.799	0.50
160_L	167_H	0.798	0.50
151_E	155_F	0.798	0.50
98_G	122_L	0.796	0.50
100_F	133_S	0.794	0.50
67_N	105_P	0.792	0.50
99_S	131_P	0.778	0.48
121_L	132_L	0.768	0.48
166_E	170_R	0.768	0.48
65_P	73_Y	0.763	0.47
23_V	77_F	0.762	0.47
39_Q	76_A	0.761	0.47
53_K	155_F	0.754	0.46
48_F	68_C	0.753	0.46
40_Q	106_F	0.750	0.46
42_A	149_R	0.743	0.45
61_C	102_A	0.742	0.45
152_K	156_L	0.740	0.45
62_F	67_N	0.739	0.45
36_G	76_A	0.735	0.45
53_K	142_R	0.734	0.45
23_V	133_S	0.733	0.44
13_D	16_E	0.725	0.44
24_F	134_F	0.724	0.44
49_D	154_P	0.722	0.43
112_E	145_E	0.722	0.43
107_V	138_V	0.718	0.43
25_C	80_T	0.717	0.43
162_L	167_H	0.712	0.43
86_S	105_P	0.704	0.42
118_I	134_F	0.703	0.42
52_R	68_C	0.698	0.41
120_E	124_A	0.694	0.41
118_I	136_V	0.693	0.41
64_S	103_N	0.692	0.41
63_A	68_C	0.669	0.39
116_D	148_K	0.669	0.39
160_L	169_Y	0.668	0.39
49_D	123_E	0.666	0.39
42_A	60_E	0.664	0.38
34_G	39_Q	0.664	0.38
158_K	163_P	0.663	0.38
111_M	136_V	0.663	0.38
46_S	73_Y	0.663	0.38
89_S	92_D	0.661	0.38
102_A	136_V	0.658	0.38
165_G	170_R	0.658	0.38
44_P	168_G	0.654	0.38
24_F	28_L	0.652	0.37
164_A	170_R	0.649	0.37
58_T	131_P	0.644	0.37
108_E	146_A	0.640	0.36
26_L	34_G	0.638	0.36
143_D	164_A	0.638	0.36
137_I	142_R	0.637	0.36
154_P	159_H	0.637	0.36
153_S	156_L	0.637	0.36
66_L	75_S	0.636	0.36
91_F	113_A	0.636	0.36
43_L	103_N	0.632	0.36
154_P	165_G	0.628	0.35
40_Q	103_N	0.627	0.35
40_Q	105_P	0.626	0.35
36_G	41_A	0.625	0.35
37_G	114_M	0.625	0.35
15_K	129_N	0.624	0.35
100_F	132_L	0.623	0.35
37_G	140_A	0.622	0.35
98_G	101_E	0.622	0.35
55_F	135_V	0.620	0.35
12_D	16_E	0.619	0.35
35_G	47_V	0.619	0.35
35_G	101_E	0.618	0.35
123_E	129_N	0.617	0.35
151_E	164_A	0.616	0.34
162_L	169_Y	0.609	0.34
65_P	137_I	0.604	0.34
58_T	100_F	0.604	0.34
48_F	60_E	0.603	0.33
28_L	32_T	0.603	0.33
75_S	104_P	0.603	0.33
115_V	136_V	0.597	0.33
42_A	64_S	0.592	0.33
100_F	121_L	0.592	0.33
70_L	106_F	0.588	0.32
68_C	135_V	0.587	0.32
122_L	132_L	0.582	0.32
101_E	134_F	0.581	0.32
59_F	98_G	0.580	0.32
70_L	97_S	0.580	0.32
52_R	58_T	0.578	0.31
37_G	44_P	0.578	0.31
33_L	89_S	0.576	0.31
31_Q	55_F	0.574	0.31
53_K	82_K	0.574	0.31
14_P	17_E	0.574	0.31
73_Y	169_Y	0.573	0.31
146_A	164_A	0.572	0.31
60_E	64_S	0.572	0.31
44_P	65_P	0.568	0.31
155_F	159_H	0.565	0.30
159_H	163_P	0.559	0.30
165_G	168_G	0.557	0.30
43_L	66_L	0.557	0.30
24_F	101_E	0.553	0.30
51_L	65_P	0.553	0.30
159_H	164_A	0.550	0.29
39_Q	143_D	0.545	0.29
81_D	167_H	0.539	0.29
33_L	90_F	0.537	0.28
79_D	90_F	0.534	0.28
44_P	81_D	0.533	0.28
93_F	117_H	0.532	0.28
38_G	137_I	0.530	0.28
123_E	155_F	0.528	0.28
156_L	165_G	0.524	0.27
50_V	55_F	0.520	0.27
116_D	149_R	0.520	0.27
162_L	166_E	0.518	0.27
159_H	168_G	0.516	0.27
118_I	164_A	0.513	0.27
46_S	96_T	0.513	0.27
111_M	114_M	0.512	0.27
41_A	101_E	0.508	0.26
13_D	18_A	0.506	0.26
93_F	100_F	0.504	0.26
24_F	149_R	0.503	0.26
44_P	47_V	0.503	0.26
122_L	155_F	0.503	0.26
152_K	163_P	0.501	0.26
58_T	99_S	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2uz1A	4	0.3372	4.7	0.955	Contact Map
3qocA	1	0.3488	4.5	0.955	Contact Map
4w8jA	2	0.7965	4.2	0.956	Contact Map
4cidA	2	0.3198	4.2	0.956	Contact Map
2ce7A	3	0.2733	3.3	0.958	Contact Map
3eyaA	5	0.3314	3.3	0.958	Contact Map
3ufbA	1	0.9942	3.3	0.958	Contact Map
1ovmA	4	0.3372	3.2	0.958	Contact Map
2pgnA	4	0.3372	3.2	0.959	Contact Map
2c31A	4	0.343	3.2	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.