MTHFR_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MTHFR_C - Methylene-tetrahydrofolate reductase C terminal

PFAM:	PF12225	Sequences: YPALNTLFLGVERAVKVWLERCRMCGDCVLGETGGICPMTRCPKGLRNGPCGGSRDGKCEVDPDRDCAWVLIYERLKALGRLDKLEEIQPPKDWS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	95 (93)
Sequences:	9030 (3695)
Seq/√Len:	383.1
META:	0.97

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_R	84_K	3.361	1.00
58_K	66_D	3.256	1.00
70_V	74_E	3.075	1.00
9_L	24_M	3.008	1.00
36_I	68_A	2.884	1.00
54_S	70_V	2.555	1.00
66_D	71_L	2.470	1.00
34_G	76_L	2.359	1.00
62_D	65_R	2.272	1.00
2_P	31_G	2.025	1.00
23_R	40_T	1.935	1.00
53_G	60_E	1.920	1.00
58_K	64_D	1.801	1.00
32_E	89_Q	1.779	1.00
43_P	68_A	1.771	1.00
20_E	30_L	1.708	1.00
13_R	19_L	1.688	1.00
4_L	12_E	1.544	1.00
13_R	17_V	1.477	1.00
73_Y	77_K	1.470	1.00
88_I	91_P	1.447	1.00
41_R	71_L	1.402	1.00
74_E	78_A	1.364	1.00
77_K	82_L	1.347	1.00
14_A	17_V	1.324	1.00
39_M	45_G	1.268	1.00
12_E	18_W	1.216	1.00
39_M	47_R	1.200	1.00
82_L	85_L	1.192	1.00
4_L	7_L	1.188	1.00
12_E	15_V	1.166	1.00
15_V	18_W	1.155	1.00
73_Y	85_L	1.140	1.00
84_K	87_E	1.129	1.00
30_L	33_T	1.129	1.00
29_V	92_K	1.101	1.00
5_N	27_D	1.090	1.00
43_P	61_V	1.082	1.00
21_R	41_R	1.082	1.00
33_T	72_I	1.065	1.00
10_G	14_A	1.056	1.00
61_V	65_R	1.016	1.00
11_V	14_A	1.010	1.00
32_E	87_E	1.005	1.00
73_Y	82_L	1.004	1.00
74_E	77_K	0.996	1.00
43_P	65_R	0.976	1.00
11_V	21_R	0.964	1.00
71_L	74_E	0.961	1.00
14_A	18_W	0.941	1.00
83_D	86_E	0.940	1.00
12_E	16_K	0.924	1.00
76_L	81_R	0.912	1.00
29_V	32_E	0.890	1.00
55_R	63_P	0.888	1.00
55_R	58_K	0.874	1.00
29_V	47_R	0.873	1.00
86_E	89_Q	0.872	1.00
52_G	60_E	0.868	1.00
34_G	79_L	0.866	1.00
36_I	75_R	0.859	1.00
6_T	9_L	0.852	1.00
82_L	86_E	0.852	1.00
66_D	74_E	0.851	1.00
44_K	60_E	0.844	1.00
77_K	80_G	0.836	1.00
68_A	72_I	0.833	1.00
4_L	8_F	0.826	1.00
58_K	62_D	0.820	1.00
15_V	19_L	0.818	1.00
29_V	33_T	0.816	1.00
8_F	11_V	0.812	1.00
44_K	52_G	0.786	1.00
36_I	41_R	0.784	1.00
76_L	82_L	0.768	1.00
6_T	10_G	0.767	1.00
8_F	12_E	0.761	1.00
27_D	92_K	0.760	1.00
36_I	71_L	0.753	1.00
22_C	29_V	0.747	1.00
38_P	72_I	0.744	1.00
69_W	72_I	0.740	1.00
7_L	11_V	0.735	1.00
11_V	19_L	0.735	1.00
76_L	85_L	0.723	1.00
75_R	79_L	0.718	1.00
36_I	72_I	0.715	1.00
58_K	63_P	0.712	1.00
41_R	68_A	0.710	1.00
7_L	12_E	0.694	0.99
4_L	11_V	0.690	0.99
27_D	93_D	0.689	0.99
76_L	84_K	0.688	0.99
18_W	21_R	0.687	0.99
57_G	74_E	0.678	0.99
9_L	12_E	0.677	0.99
13_R	18_W	0.671	0.99
47_R	92_K	0.670	0.99
75_R	78_A	0.663	0.99
12_E	21_R	0.660	0.99
29_V	38_P	0.658	0.99
52_G	57_G	0.656	0.99
76_L	79_L	0.654	0.99
32_E	84_K	0.653	0.99
55_R	70_V	0.640	0.99
3_A	12_E	0.636	0.99
41_R	65_R	0.619	0.99
49_G	60_E	0.618	0.99
81_R	87_E	0.604	0.99
10_G	13_R	0.601	0.98
13_R	16_K	0.600	0.98
90_P	94_W	0.595	0.98
40_T	68_A	0.583	0.98
65_R	68_A	0.583	0.98
6_T	11_V	0.575	0.98
83_D	87_E	0.571	0.98
4_L	16_K	0.563	0.98
39_M	92_K	0.559	0.98
11_V	15_V	0.558	0.98
49_G	53_G	0.557	0.98
12_E	26_G	0.553	0.97
7_L	18_W	0.542	0.97
54_S	65_R	0.541	0.97
16_K	21_R	0.540	0.97
4_L	18_W	0.537	0.97
12_E	17_V	0.535	0.97
26_G	48_N	0.530	0.97
78_A	83_D	0.530	0.97
23_R	39_M	0.530	0.97
11_V	31_G	0.522	0.96
80_G	83_D	0.522	0.96
29_V	39_M	0.520	0.96
35_G	72_I	0.519	0.96
22_C	31_G	0.519	0.96
46_L	61_V	0.518	0.96
7_L	24_M	0.514	0.96
88_I	94_W	0.512	0.96
16_K	19_L	0.503	0.96
43_P	62_D	0.503	0.96
9_L	13_R	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zbuA	1	0.6211	5.5	0.937	Contact Map
2c42A	2	0.8421	4.7	0.939	Contact Map
1kf6B	1	0.6421	4.1	0.94	Contact Map
4g2uA	2	0.4526	3.5	0.943	Contact Map
1h7bA	2	0.3895	3.4	0.943	Contact Map
2d10E	1	0.1158	3.1	0.944	Contact Map
2d11E	1	0.0947	3	0.944	Contact Map
1mhmA	1	0.8947	2.7	0.946	Contact Map
2md0A	1	0.4526	2.5	0.946	Contact Map
3swrA	1	0.8947	2.5	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.