DUF3593 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3593 - Protein of unknown function (DUF3593)

PFAM:	PF12159	Sequences: EPLFALSLFPYLGFLWFLTRSKSTPKLALIGFYLTLLFVAVTIPAGIYAKVVYGKSLANVDWLHGGAESFLTLSNLLIVLGFRQALK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	87 (85)
Sequences:	635 (262)
Seq/√Len:	28.4
META:	0.775

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_K	59_N	4.236	1.00
34_L	37_L	2.896	1.00
19_T	33_Y	2.668	1.00
8_L	12_L	2.134	0.98
48_Y	52_V	1.849	0.95
74_S	83_R	1.821	0.94
14_F	32_F	1.746	0.93
78_I	82_F	1.737	0.92
41_V	70_F	1.712	0.92
34_L	77_L	1.699	0.92
35_T	74_S	1.671	0.91
18_L	24_T	1.639	0.90
29_L	33_Y	1.550	0.87
66_G	69_S	1.547	0.87
7_S	10_P	1.518	0.86
34_L	73_L	1.456	0.84
65_G	68_E	1.441	0.83
4_F	7_S	1.438	0.83
28_A	82_F	1.438	0.83
30_I	34_L	1.416	0.82
79_V	82_F	1.386	0.81
76_L	83_R	1.385	0.80
4_F	10_P	1.367	0.80
42_T	72_T	1.355	0.79
44_P	48_Y	1.347	0.79
49_A	63_L	1.329	0.78
27_L	80_L	1.302	0.76
47_I	50_K	1.300	0.76
45_A	75_N	1.272	0.74
68_E	71_L	1.263	0.74
7_S	67_A	1.256	0.73
7_S	14_F	1.245	0.73
3_L	9_F	1.217	0.71
80_L	83_R	1.192	0.69
34_L	70_F	1.183	0.69
20_R	45_A	1.171	0.68
55_K	60_V	1.126	0.65
11_Y	14_F	1.098	0.63
20_R	23_S	1.094	0.63
30_I	33_Y	1.087	0.62
1_E	6_L	1.075	0.61
5_A	9_F	1.071	0.61
31_G	68_E	1.057	0.60
42_T	58_A	1.027	0.58
32_F	78_I	1.022	0.57
31_G	71_L	1.020	0.57
2_P	46_G	0.998	0.55
8_L	25_P	0.972	0.53
25_P	36_L	0.970	0.53
61_D	64_H	0.968	0.53
7_S	32_F	0.964	0.53
37_L	49_A	0.962	0.53
31_G	65_G	0.947	0.52
28_A	74_S	0.934	0.51
22_K	69_S	0.908	0.49
82_F	85_A	0.902	0.48
4_F	8_L	0.897	0.48
37_L	73_L	0.886	0.47
13_G	17_F	0.880	0.46
18_L	30_I	0.880	0.46
62_W	79_V	0.875	0.46
51_V	66_G	0.875	0.46
44_P	50_K	0.866	0.45
19_T	30_I	0.843	0.44
28_A	59_N	0.843	0.44
2_P	6_L	0.841	0.43
45_A	63_L	0.839	0.43
50_K	59_N	0.835	0.43
20_R	49_A	0.834	0.43
19_T	29_L	0.832	0.43
54_G	80_L	0.815	0.41
2_P	5_A	0.793	0.40
67_A	71_L	0.792	0.40
65_G	71_L	0.789	0.40
42_T	67_A	0.787	0.39
42_T	81_G	0.769	0.38
41_V	74_S	0.766	0.38
40_A	73_L	0.751	0.37
24_T	35_T	0.744	0.36
24_T	85_A	0.740	0.36
28_A	58_A	0.738	0.36
10_P	39_V	0.737	0.36
74_S	78_I	0.735	0.36
1_E	9_F	0.731	0.35
14_F	79_V	0.730	0.35
47_I	53_Y	0.724	0.35
76_L	79_V	0.723	0.35
19_T	79_V	0.716	0.34
33_Y	40_A	0.715	0.34
64_H	68_E	0.712	0.34
39_V	43_I	0.702	0.33
1_E	23_S	0.692	0.33
18_L	35_T	0.681	0.32
16_W	23_S	0.677	0.32
5_A	58_A	0.669	0.31
26_K	48_Y	0.661	0.31
14_F	67_A	0.659	0.30
21_S	29_L	0.653	0.30
46_G	65_G	0.647	0.30
56_S	59_N	0.637	0.29
56_S	70_F	0.634	0.29
25_P	85_A	0.631	0.29
2_P	37_L	0.627	0.28
17_F	30_I	0.626	0.28
45_A	49_A	0.625	0.28
5_A	66_G	0.618	0.28
34_L	74_S	0.616	0.28
31_G	67_A	0.615	0.28
15_L	57_L	0.598	0.27
50_K	54_G	0.587	0.26
8_L	17_F	0.584	0.26
43_I	47_I	0.577	0.25
14_F	78_I	0.576	0.25
2_P	13_G	0.571	0.25
56_S	79_V	0.569	0.25
3_L	8_L	0.548	0.24
36_L	69_S	0.543	0.23
52_V	66_G	0.538	0.23
30_I	40_A	0.538	0.23
9_F	44_P	0.537	0.23
18_L	29_L	0.534	0.23
39_V	57_L	0.528	0.23
60_V	70_F	0.527	0.23
71_L	81_G	0.526	0.22
6_L	22_K	0.521	0.22
46_G	76_L	0.510	0.22
24_T	28_A	0.504	0.21
45_A	48_Y	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3m73A	3	0.8621	6.2	0.932	Contact Map
3ayfA	2	0.9885	6.2	0.932	Contact Map
4ryoA	1	0.3333	3.1	0.941	Contact Map
1milA	1	0.3793	3	0.942	Contact Map
3wfdB	1	0.9655	2.1	0.946	Contact Map
1bnxA	1	0.2414	1.3	0.952	Contact Map
4cbcA	3	0.6322	1.2	0.954	Contact Map
4fc5A	5	0.5172	1.1	0.955	Contact Map
3mk7A	1	1	1.1	0.955	Contact Map
1bzkA	1	0.2414	1	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.