DUF3592 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3592 - Protein of unknown function (DUF3592)

PFAM:	PF12158	Sequences: GWFLLLFGLIFLLVGLALLVLGLRLLLRRARASRSWPTTEGTVVSSETESRRSDGGGGTTYRPVVRYTYEDGRRYTGFTSGSDNVGSSPPRYPVGDTVTVYYDPANPSEAVLEPRVRGWGGLWLLPLLLAGFILGLVFLLIGLFLLLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	148 (131)
Sequences:	17236 (15473)
Seq/√Len:	1351.8
META:	0.892

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_G	100_V	4.507	1.00
38_T	99_T	3.531	1.00
32_A	36_W	3.489	1.00
40_E	97_T	3.175	1.00
93_P	96_D	3.074	1.00
103_D	109_E	3.041	1.00
40_E	99_T	3.016	1.00
38_T	101_Y	3.012	1.00
69_Y	75_Y	2.358	1.00
17_A	21_L	2.319	1.00
42_T	97_T	2.292	1.00
39_T	102_Y	2.196	1.00
20_V	24_R	2.179	1.00
69_Y	102_Y	1.976	1.00
23_L	27_L	1.960	1.00
44_V	68_T	1.957	1.00
85_V	89_P	1.909	1.00
41_G	98_V	1.838	1.00
45_S	64_V	1.560	1.00
36_W	103_D	1.555	1.00
44_V	66_R	1.540	1.00
68_T	74_R	1.469	1.00
123_W	128_L	1.415	1.00
86_G	89_P	1.400	1.00
66_R	76_T	1.395	1.00
101_Y	113_E	1.379	1.00
24_R	28_R	1.367	1.00
127_L	131_G	1.358	1.00
100_V	110_A	1.355	1.00
21_L	25_L	1.314	1.00
36_W	101_Y	1.305	1.00
31_R	35_S	1.296	1.00
13_L	17_A	1.232	1.00
42_T	68_T	1.224	1.00
69_Y	110_A	1.217	1.00
46_S	93_P	1.203	1.00
101_Y	111_V	1.200	1.00
46_S	94_V	1.193	1.00
47_E	64_V	1.187	1.00
126_P	129_L	1.176	1.00
62_R	86_G	1.164	1.00
86_G	90_P	1.146	1.00
65_V	69_Y	1.130	1.00
85_V	88_S	1.121	1.00
123_W	126_P	1.119	1.00
45_S	94_V	1.117	1.00
122_L	126_P	1.103	1.00
106_N	109_E	1.085	1.00
123_W	127_L	1.073	1.00
37_P	101_Y	1.071	1.00
66_R	74_R	1.056	1.00
100_V	112_L	1.028	1.00
31_R	34_R	1.025	1.00
69_Y	72_G	1.024	1.00
30_A	34_R	1.023	1.00
9_L	13_L	1.019	1.00
12_L	16_L	1.018	1.00
37_P	104_P	1.011	1.00
125_L	129_L	1.000	1.00
22_G	26_L	0.999	1.00
45_S	66_R	0.995	1.00
46_S	96_D	0.990	1.00
38_T	113_E	0.982	1.00
124_L	128_L	0.978	1.00
23_L	26_L	0.972	1.00
22_G	25_L	0.972	1.00
16_L	20_V	0.969	1.00
33_S	111_V	0.969	1.00
43_V	92_Y	0.952	1.00
33_S	37_P	0.950	1.00
88_S	91_R	0.947	1.00
15_G	19_L	0.945	1.00
29_R	33_S	0.942	1.00
122_L	125_L	0.941	1.00
65_V	110_A	0.933	1.00
35_S	103_D	0.932	1.00
8_G	12_L	0.932	1.00
32_A	111_V	0.928	1.00
99_T	113_E	0.913	1.00
37_P	102_Y	0.907	1.00
92_Y	95_G	0.905	1.00
128_L	131_G	0.901	1.00
26_L	30_A	0.901	1.00
123_W	130_A	0.892	1.00
78_F	82_S	0.892	1.00
36_W	111_V	0.880	1.00
7_F	11_F	0.877	1.00
52_R	55_G	0.874	1.00
79_T	82_S	0.870	1.00
39_T	100_V	0.861	1.00
69_Y	73_R	0.856	1.00
137_V	141_I	0.852	1.00
15_G	22_G	0.846	1.00
25_L	29_R	0.838	1.00
78_F	110_A	0.837	1.00
33_S	36_W	0.836	1.00
103_D	106_N	0.829	1.00
46_S	90_P	0.827	1.00
30_A	33_S	0.825	1.00
10_I	14_V	0.814	1.00
92_Y	96_D	0.806	1.00
127_L	130_A	0.784	1.00
11_F	15_G	0.780	1.00
121_G	124_L	0.778	1.00
126_P	130_A	0.776	1.00
51_R	56_G	0.775	1.00
75_Y	108_S	0.772	1.00
28_R	32_A	0.770	1.00
92_Y	98_V	0.768	1.00
73_R	76_T	0.765	1.00
87_S	91_R	0.764	1.00
50_S	55_G	0.762	1.00
41_G	102_Y	0.756	1.00
29_R	111_V	0.755	1.00
53_S	57_G	0.752	1.00
44_V	76_T	0.748	1.00
67_Y	110_A	0.744	1.00
51_R	54_D	0.734	1.00
98_V	112_L	0.734	1.00
21_L	24_R	0.729	1.00
14_V	18_L	0.726	1.00
53_S	56_G	0.724	1.00
54_D	57_G	0.723	1.00
43_V	65_V	0.721	1.00
81_G	84_N	0.720	1.00
80_S	83_D	0.717	1.00
9_L	12_L	0.707	1.00
42_T	95_G	0.695	1.00
136_L	140_L	0.694	1.00
49_E	57_G	0.693	1.00
12_L	15_G	0.690	1.00
18_L	21_L	0.684	1.00
19_L	22_G	0.680	1.00
20_V	23_L	0.678	1.00
135_G	139_L	0.678	1.00
121_G	125_L	0.676	1.00
17_A	20_V	0.673	1.00
85_V	91_R	0.673	1.00
37_P	70_E	0.668	1.00
19_L	23_L	0.664	1.00
110_A	113_E	0.654	1.00
50_S	53_S	0.654	1.00
36_W	109_E	0.648	1.00
46_S	92_Y	0.647	1.00
78_F	81_G	0.642	1.00
124_L	127_L	0.642	1.00
60_T	63_P	0.635	1.00
25_L	28_R	0.626	1.00
52_R	56_G	0.625	1.00
52_R	57_G	0.622	1.00
15_G	18_L	0.619	1.00
36_W	104_P	0.610	1.00
14_V	17_A	0.597	1.00
125_L	130_A	0.597	1.00
24_R	27_L	0.597	1.00
27_L	31_R	0.596	1.00
137_V	140_L	0.595	1.00
6_L	10_I	0.592	1.00
107_P	110_A	0.590	1.00
43_V	46_S	0.589	1.00
62_R	79_T	0.588	1.00
52_R	58_G	0.588	1.00
123_W	129_L	0.588	1.00
28_R	109_E	0.584	1.00
18_L	22_G	0.583	1.00
121_G	126_P	0.583	1.00
52_R	59_T	0.580	1.00
49_E	52_R	0.574	1.00
78_F	83_D	0.573	1.00
139_L	143_L	0.569	1.00
44_V	94_V	0.568	1.00
43_V	98_V	0.567	1.00
38_T	100_V	0.563	1.00
41_G	67_Y	0.561	1.00
50_S	56_G	0.561	1.00
46_S	63_P	0.561	1.00
59_T	63_P	0.548	1.00
50_S	57_G	0.546	1.00
50_S	59_T	0.540	1.00
87_S	90_P	0.539	1.00
46_S	89_P	0.538	1.00
122_L	130_A	0.534	1.00
55_G	58_G	0.534	1.00
120_G	123_W	0.533	1.00
92_Y	112_L	0.531	1.00
32_A	35_S	0.528	1.00
125_L	128_L	0.528	1.00
8_G	11_F	0.525	1.00
92_Y	113_E	0.524	1.00
50_S	54_D	0.520	1.00
121_G	127_L	0.517	1.00
131_G	134_L	0.516	1.00
13_L	16_L	0.513	1.00
12_L	19_L	0.513	1.00
40_E	100_V	0.507	1.00
75_Y	78_F	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1v54D	1	0.6757	37.3	0.868	Contact Map
3h90A	3	0.7027	33.4	0.872	Contact Map
2y69D	1	0.6757	21.4	0.883	Contact Map
3j1zP	8	0.7297	9.5	0.901	Contact Map
3wguB	1	0.3851	7.9	0.904	Contact Map
3ixzB	1	0.2027	7.6	0.905	Contact Map
2zxeB	1	0.2095	7.4	0.906	Contact Map
5a2fA	1	0	5.5	0.911	Contact Map
4um9B	2	0	5.5	0.911	Contact Map
1ah9A	1	0.4797	4.9	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.