ATPase-cat_bd - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATPase-cat_bd - Putative metal-binding domain of cation transport ATPase

PFAM:	PF12156	Sequences: ACFHCGLPCPAGARLTVEIDGEEKPFCCAGCKAVYELIVENGLDDYYRLRTAPGIRPEEAPPEELGDKFAYLDDPEVQAKFVRFE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	85 (81)
Sequences:	8975 (6351)
Seq/√Len:	705.7
META:	0.899

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_D	48_R	3.341	1.00
3_F	24_K	2.915	1.00
78_Q	82_V	2.670	1.00
32_K	36_E	2.658	1.00
16_T	23_E	2.583	1.00
17_V	26_F	2.404	1.00
29_A	32_K	2.319	1.00
39_V	44_D	2.062	1.00
67_D	70_A	1.949	1.00
15_L	29_A	1.931	1.00
18_E	23_E	1.890	1.00
29_A	33_A	1.799	1.00
45_D	49_L	1.674	1.00
15_L	32_K	1.672	1.00
74_D	77_V	1.637	1.00
46_Y	54_G	1.610	1.00
36_E	40_E	1.567	1.00
33_A	36_E	1.561	1.00
75_P	79_A	1.541	1.00
21_G	36_E	1.492	1.00
20_D	25_P	1.478	1.00
35_Y	39_V	1.398	1.00
26_F	35_Y	1.349	1.00
9_C	25_P	1.331	1.00
37_L	41_N	1.318	1.00
76_E	79_A	1.312	1.00
18_E	25_P	1.307	1.00
19_I	26_F	1.251	1.00
17_V	32_K	1.234	1.00
75_P	78_Q	1.202	1.00
7_L	56_R	1.201	1.00
18_E	21_G	1.192	1.00
44_D	48_R	1.150	1.00
16_T	25_P	1.143	1.00
1_A	6_G	1.118	1.00
20_D	48_R	1.097	1.00
9_C	12_G	1.053	1.00
3_F	35_Y	1.043	1.00
77_V	81_F	1.036	1.00
34_V	37_L	1.027	1.00
10_P	17_V	0.998	1.00
21_G	32_K	0.985	1.00
49_L	53_P	0.982	1.00
12_G	18_E	0.973	1.00
72_L	81_F	0.937	1.00
33_A	37_L	0.932	1.00
1_A	8_P	0.921	1.00
74_D	78_Q	0.919	1.00
10_P	18_E	0.909	1.00
19_I	35_Y	0.908	1.00
15_L	26_F	0.908	1.00
67_D	71_Y	0.879	1.00
37_L	72_L	0.878	1.00
48_R	51_T	0.876	1.00
35_Y	38_I	0.853	1.00
26_F	39_V	0.843	1.00
34_V	38_I	0.840	1.00
6_G	9_C	0.837	1.00
24_K	35_Y	0.826	1.00
19_I	39_V	0.817	1.00
26_F	32_K	0.803	1.00
2_C	5_C	0.790	1.00
60_A	63_E	0.766	1.00
16_T	26_F	0.754	1.00
70_A	73_D	0.750	1.00
30_G	33_A	0.734	1.00
42_G	45_D	0.732	1.00
34_V	74_D	0.727	1.00
21_G	25_P	0.717	1.00
49_L	69_F	0.713	1.00
63_E	66_G	0.710	1.00
50_R	53_P	0.710	1.00
3_F	19_I	0.705	1.00
19_I	24_K	0.689	1.00
52_A	55_I	0.683	1.00
37_L	69_F	0.678	1.00
11_A	18_E	0.674	1.00
43_L	77_V	0.673	1.00
34_V	41_N	0.672	1.00
78_Q	81_F	0.664	1.00
73_D	78_Q	0.663	1.00
68_K	71_Y	0.658	1.00
20_D	39_V	0.655	1.00
17_V	36_E	0.649	1.00
38_I	46_Y	0.649	1.00
69_F	73_D	0.642	1.00
30_G	34_V	0.641	1.00
65_L	69_F	0.639	1.00
77_V	83_R	0.635	1.00
21_G	24_K	0.622	1.00
51_T	54_G	0.622	1.00
64_E	67_D	0.615	1.00
39_V	42_G	0.612	1.00
74_D	82_V	0.610	1.00
20_D	44_D	0.593	1.00
67_D	83_R	0.588	1.00
46_Y	53_P	0.579	1.00
59_E	62_P	0.579	1.00
56_R	59_E	0.575	1.00
54_G	57_P	0.573	1.00
37_L	49_L	0.573	1.00
61_P	64_E	0.570	1.00
7_L	37_L	0.562	1.00
61_P	65_L	0.552	1.00
55_I	58_E	0.549	1.00
80_K	83_R	0.548	1.00
17_V	39_V	0.547	1.00
69_F	72_L	0.542	1.00
9_C	15_L	0.540	1.00
3_F	21_G	0.535	1.00
37_L	57_P	0.535	1.00
42_G	50_R	0.532	1.00
10_P	25_P	0.526	1.00
43_L	46_Y	0.525	1.00
44_D	50_R	0.525	1.00
71_Y	76_E	0.518	1.00
62_P	65_L	0.517	1.00
65_L	68_K	0.512	0.99
68_K	72_L	0.509	0.99
57_P	61_P	0.504	0.99
19_I	22_E	0.501	0.99
38_I	50_R	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fqhA	1	0.9059	82.7	0.802	Contact Map
3u52A	2	0.8353	78.1	0.811	Contact Map
1mtyD	2	0.9529	75.9	0.814	Contact Map
2incA	2	0.8588	74.1	0.817	Contact Map
3ge3A	2	0.8588	72.7	0.819	Contact Map
2dasA	1	0.4824	47	0.846	Contact Map
2kq9A	1	0.3529	42	0.851	Contact Map
4tmaI	1	0.5647	31.3	0.861	Contact Map
2hpuA	1	0.8471	31	0.861	Contact Map
2kgoA	1	0.6	28.6	0.864	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.