DUF3577 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3577 - Protein of unknown function (DUF3577)

PFAM:	PF12101	Sequences: TSNEKKYFDLHTTGIGYLNRIREVTPKKGDPFLACTIAALRGPADDVEYTYFDCRVSGKEAQELVRRLQPAVEAEKKVLIGFRLGDLYADTFTYKKGEKAGETGVSLKGRLLRIKWIKVDGEVVYKAEPKDS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	132 (128)
Sequences:	675 (426)
Seq/√Len:	37.6
META:	0.673

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_Y	104_G	3.285	1.00
84_L	109_G	3.266	1.00
41_R	50_T	2.882	1.00
68_L	117_I	2.514	1.00
36_T	51_Y	2.457	1.00
72_V	78_V	2.456	1.00
64_L	117_I	2.400	1.00
87_L	109_G	2.195	0.99
81_G	116_W	2.182	0.99
21_I	72_V	2.159	0.99
92_F	104_G	2.061	0.99
14_G	82_F	1.972	0.98
60_E	63_E	1.963	0.98
69_Q	73_E	1.952	0.98
76_K	120_D	1.927	0.98
80_I	114_I	1.899	0.98
13_T	83_R	1.859	0.98
93_T	103_T	1.830	0.98
16_G	37_I	1.800	0.97
23_E	66_R	1.762	0.97
39_A	82_F	1.750	0.97
68_L	71_A	1.718	0.96
89_A	105_V	1.701	0.96
33_L	56_V	1.672	0.96
91_T	103_T	1.657	0.95
91_T	105_V	1.523	0.93
87_L	107_L	1.523	0.93
99_K	102_E	1.510	0.93
50_T	54_C	1.500	0.92
123_V	126_K	1.463	0.91
85_G	112_L	1.454	0.91
9_D	112_L	1.438	0.91
8_F	17_Y	1.430	0.90
15_I	79_L	1.422	0.90
62_Q	66_R	1.407	0.90
97_G	102_E	1.402	0.90
6_K	9_D	1.374	0.89
33_L	62_Q	1.367	0.88
52_F	84_L	1.366	0.88
38_A	51_Y	1.357	0.88
12_T	84_L	1.348	0.88
40_L	47_V	1.326	0.87
33_L	66_R	1.313	0.86
35_C	72_V	1.304	0.86
40_L	79_L	1.298	0.86
17_Y	49_Y	1.287	0.85
9_D	13_T	1.253	0.83
26_P	29_G	1.233	0.82
39_A	52_F	1.224	0.82
8_F	118_K	1.213	0.81
90_D	106_S	1.206	0.81
20_R	36_T	1.169	0.79
56_V	61_A	1.164	0.79
38_A	49_Y	1.160	0.78
58_G	110_R	1.117	0.76
101_G	104_G	1.116	0.76
70_P	74_A	1.116	0.76
113_R	127_A	1.100	0.75
9_D	20_R	1.081	0.73
97_G	100_A	1.055	0.71
34_A	53_D	1.051	0.71
64_L	68_L	1.041	0.70
92_F	97_G	1.038	0.70
78_V	119_V	1.034	0.70
58_G	112_L	1.029	0.69
97_G	101_G	1.015	0.68
105_V	109_G	1.005	0.68
92_F	101_G	0.977	0.65
18_L	72_V	0.976	0.65
10_L	14_G	0.976	0.65
18_L	65_V	0.969	0.65
41_R	88_Y	0.964	0.64
58_G	85_G	0.961	0.64
12_T	87_L	0.959	0.64
16_G	52_F	0.958	0.64
16_G	39_A	0.948	0.63
21_I	69_Q	0.946	0.63
28_K	48_E	0.944	0.63
50_T	87_L	0.943	0.63
103_T	107_L	0.923	0.61
10_L	16_G	0.901	0.59
54_C	109_G	0.888	0.58
79_L	116_W	0.872	0.56
67_R	119_V	0.870	0.56
10_L	39_A	0.868	0.56
59_K	63_E	0.865	0.56
61_A	112_L	0.865	0.56
23_E	31_P	0.863	0.56
65_V	123_V	0.857	0.55
33_L	65_V	0.855	0.55
36_T	54_C	0.854	0.55
76_K	119_V	0.854	0.55
24_V	34_A	0.851	0.55
12_T	52_F	0.840	0.54
37_I	82_F	0.825	0.52
56_V	62_Q	0.822	0.52
126_K	129_P	0.818	0.52
67_R	125_Y	0.802	0.50
63_E	67_R	0.801	0.50
89_A	119_V	0.787	0.49
37_I	80_I	0.782	0.49
27_K	88_Y	0.777	0.48
96_K	114_I	0.757	0.46
93_T	110_R	0.752	0.46
44_A	65_V	0.742	0.45
68_L	119_V	0.741	0.45
94_Y	102_E	0.740	0.45
28_K	85_G	0.736	0.44
26_P	30_D	0.735	0.44
71_A	76_K	0.719	0.43
6_K	15_I	0.715	0.43
59_K	114_I	0.713	0.42
21_I	78_V	0.708	0.42
17_Y	40_L	0.706	0.42
52_F	87_L	0.706	0.42
49_Y	79_L	0.705	0.42
24_V	110_R	0.701	0.41
29_G	40_L	0.698	0.41
89_A	130_K	0.695	0.41
90_D	108_K	0.694	0.41
9_D	110_R	0.692	0.41
23_E	33_L	0.688	0.40
43_P	50_T	0.683	0.40
127_A	130_K	0.680	0.40
35_C	80_I	0.678	0.39
61_A	85_G	0.673	0.39
86_D	108_K	0.672	0.39
16_G	84_L	0.664	0.38
116_W	123_V	0.660	0.38
66_R	69_Q	0.658	0.38
18_L	78_V	0.653	0.37
95_K	129_P	0.636	0.36
6_K	44_A	0.632	0.36
35_C	86_D	0.631	0.36
22_R	108_K	0.628	0.35
15_I	81_G	0.627	0.35
125_Y	130_K	0.622	0.35
53_D	108_K	0.618	0.34
88_Y	102_E	0.618	0.34
25_T	75_E	0.617	0.34
99_K	104_G	0.615	0.34
67_R	76_K	0.614	0.34
82_F	117_I	0.614	0.34
6_K	126_K	0.605	0.33
59_K	98_E	0.602	0.33
11_H	32_F	0.599	0.33
6_K	35_C	0.599	0.33
27_K	55_R	0.596	0.33
12_T	51_Y	0.594	0.33
14_G	37_I	0.593	0.32
37_I	54_C	0.590	0.32
15_I	116_W	0.588	0.32
30_D	69_Q	0.578	0.31
24_V	61_A	0.577	0.31
97_G	104_G	0.575	0.31
81_G	118_K	0.575	0.31
58_G	61_A	0.574	0.31
50_T	88_Y	0.566	0.30
9_D	85_G	0.566	0.30
113_R	130_K	0.563	0.30
22_R	53_D	0.560	0.30
21_I	35_C	0.559	0.30
60_E	64_L	0.555	0.30
53_D	83_R	0.554	0.30
24_V	32_F	0.553	0.29
17_Y	79_L	0.553	0.29
50_T	89_A	0.551	0.29
41_R	90_D	0.549	0.29
8_F	11_H	0.549	0.29
126_K	130_K	0.547	0.29
47_V	79_L	0.547	0.29
30_D	75_E	0.545	0.29
80_I	112_L	0.541	0.29
9_D	101_G	0.540	0.29
67_R	73_E	0.540	0.29
79_L	97_G	0.539	0.28
95_K	109_G	0.537	0.28
79_L	87_L	0.537	0.28
50_T	102_E	0.536	0.28
98_E	102_E	0.535	0.28
19_N	38_A	0.529	0.28
75_E	130_K	0.527	0.28
50_T	91_T	0.527	0.28
55_R	81_G	0.519	0.27
32_F	89_A	0.518	0.27
41_R	47_V	0.517	0.27
20_R	86_D	0.517	0.27
65_V	81_G	0.516	0.27
13_T	115_K	0.512	0.27
53_D	112_L	0.501	0.26
78_V	118_K	0.501	0.26
15_I	47_V	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lgjA	2	0.6591	21.7	0.934	Contact Map
3vdyA	3	0.7424	12.5	0.94	Contact Map
2mjgA	2	0.3333	12.4	0.94	Contact Map
3eivA	3	0.8182	11.8	0.941	Contact Map
4qqbX	1	0.447	11.2	0.942	Contact Map
3pgzA	2	0.7727	8.5	0.945	Contact Map
3afpA	3	0.7879	8.2	0.945	Contact Map
1z9fA	4	0.6061	7.8	0.946	Contact Map
4dniA	1	0.8333	7.5	0.946	Contact Map
2fxqA	2	0.7197	7.3	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.