DUF3574 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3574 - Protein of unknown function (DUF3574)

PFAM:	PF12098	Sequences: RTELYFGRNIPDRGGGVSEAEWQAFLDEEVTPRFPDGLTVLDAYGQWRGADGRIVRERSKVLIIVHPDTPAARAKIEAIRAAYKRRFRQESVLRVTRPVCVSF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	103 (101)
Sequences:	5035 (3423)
Seq/√Len:	340.6
META:	0.92

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_L	63_I	2.698	1.00
42_D	60_K	2.681	1.00
24_A	28_E	2.655	1.00
8_R	60_K	2.600	1.00
43_A	59_S	2.512	1.00
33_R	78_A	2.413	1.00
30_V	62_L	2.229	1.00
30_V	79_I	2.123	1.00
41_L	61_V	2.101	1.00
39_T	43_A	2.035	1.00
29_E	82_A	2.034	1.00
31_T	46_Q	1.797	1.00
74_A	78_A	1.760	1.00
80_R	94_R	1.712	1.00
2_T	66_H	1.670	1.00
66_H	72_A	1.638	1.00
3_E	63_I	1.637	1.00
46_Q	54_I	1.637	1.00
12_D	15_G	1.551	1.00
28_E	86_R	1.542	1.00
10_I	88_R	1.532	1.00
77_E	80_R	1.505	1.00
26_L	30_V	1.504	1.00
81_A	84_K	1.481	1.00
10_I	15_G	1.479	1.00
10_I	21_E	1.454	1.00
42_D	58_R	1.426	1.00
18_S	21_E	1.414	1.00
38_L	46_Q	1.394	1.00
43_A	61_V	1.356	1.00
2_T	96_T	1.349	1.00
11_P	14_G	1.347	1.00
26_L	40_V	1.330	1.00
71_A	75_K	1.258	1.00
16_G	58_R	1.236	1.00
83_Y	87_F	1.227	1.00
29_E	33_R	1.216	1.00
46_Q	56_R	1.200	1.00
69_T	72_A	1.190	1.00
22_W	40_V	1.186	1.00
49_G	90_E	1.186	1.00
8_R	19_E	1.183	1.00
49_G	53_R	1.171	1.00
31_T	38_L	1.162	1.00
25_F	79_I	1.156	1.00
47_W	91_S	1.151	1.00
82_A	86_R	1.145	1.00
23_Q	27_D	1.138	1.00
50_A	90_E	1.137	1.00
6_F	22_W	1.132	1.00
10_I	17_V	1.128	1.00
77_E	81_A	1.122	1.00
72_A	75_K	1.113	1.00
57_E	89_Q	1.110	1.00
68_D	73_R	1.070	1.00
81_A	85_R	1.054	1.00
29_E	86_R	1.049	1.00
34_F	64_I	1.032	1.00
68_D	72_A	1.029	1.00
95_V	99_V	1.024	1.00
11_P	15_G	1.010	1.00
36_D	48_R	1.004	1.00
75_K	78_A	0.959	1.00
8_R	17_V	0.957	1.00
82_A	85_R	0.917	1.00
65_V	95_V	0.913	1.00
48_R	52_G	0.906	1.00
93_L	101_V	0.886	1.00
48_R	54_I	0.874	1.00
38_L	64_I	0.873	1.00
8_R	58_R	0.863	1.00
5_Y	63_I	0.862	1.00
5_Y	93_L	0.853	1.00
19_E	23_Q	0.850	1.00
10_I	16_G	0.846	1.00
29_E	78_A	0.834	1.00
70_P	74_A	0.828	1.00
5_Y	95_V	0.828	1.00
11_P	16_G	0.818	1.00
2_T	76_I	0.811	1.00
35_P	48_R	0.804	1.00
29_E	79_I	0.800	1.00
66_H	94_R	0.784	1.00
3_E	95_V	0.735	0.99
73_R	77_E	0.734	0.99
33_R	82_A	0.733	0.99
79_I	82_A	0.733	0.99
22_W	47_W	0.732	0.99
73_R	96_T	0.732	0.99
10_I	14_G	0.723	0.99
78_A	82_A	0.718	0.99
38_L	54_I	0.715	0.99
31_T	54_I	0.714	0.99
26_L	38_L	0.712	0.99
47_W	90_E	0.703	0.99
12_D	88_R	0.697	0.99
19_E	42_D	0.689	0.99
24_A	86_R	0.688	0.99
65_V	93_L	0.682	0.99
9_N	16_G	0.677	0.99
93_L	96_T	0.673	0.99
21_E	24_A	0.672	0.99
7_G	57_E	0.661	0.99
9_N	55_V	0.656	0.99
83_Y	89_Q	0.655	0.99
90_E	93_L	0.646	0.99
6_F	25_F	0.640	0.99
20_A	24_A	0.633	0.98
93_L	103_F	0.631	0.98
26_L	32_P	0.626	0.98
26_L	33_R	0.622	0.98
9_N	12_D	0.620	0.98
5_Y	59_S	0.619	0.98
2_T	5_Y	0.613	0.98
60_K	63_I	0.613	0.98
31_T	35_P	0.601	0.98
36_D	72_A	0.595	0.98
67_P	72_A	0.590	0.97
44_Y	58_R	0.586	0.97
19_E	60_K	0.580	0.97
22_W	26_L	0.579	0.97
73_R	94_R	0.569	0.97
80_R	84_K	0.559	0.97
66_H	96_T	0.557	0.96
80_R	96_T	0.555	0.96
9_N	14_G	0.553	0.96
52_G	64_I	0.551	0.96
22_W	25_F	0.546	0.96
73_R	80_R	0.543	0.96
65_V	99_V	0.541	0.96
34_F	38_L	0.538	0.96
34_F	37_G	0.535	0.96
5_Y	65_V	0.532	0.95
8_R	16_G	0.531	0.95
39_T	61_V	0.527	0.95
22_W	60_K	0.523	0.95
68_D	76_I	0.520	0.95
65_V	101_V	0.518	0.95
24_A	27_D	0.517	0.95
5_Y	39_T	0.514	0.94
71_A	74_A	0.513	0.94
25_F	83_Y	0.511	0.94
97_R	101_V	0.510	0.94
47_W	89_Q	0.507	0.94
51_D	55_V	0.506	0.94
49_G	55_V	0.505	0.94
40_V	62_L	0.503	0.94
27_D	46_Q	0.502	0.94
3_E	61_V	0.502	0.94
95_V	101_V	0.501	0.94
10_I	18_S	0.501	0.94
38_L	45_G	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2dclA	5	0.8544	21.2	0.902	Contact Map
3hluA	2	0.7087	12.3	0.912	Contact Map
1o51A	3	0.8252	11.2	0.914	Contact Map
1pieA	1	0.2913	8.2	0.919	Contact Map
1dm5A	4	0.7184	7.3	0.921	Contact Map
1n00A	1	0.7087	7.2	0.921	Contact Map
3v2uC	2	0.4466	7.1	0.921	Contact Map
3lqvP	1	0.3204	5.7	0.925	Contact Map
4mduA	2	0.7961	5	0.927	Contact Map
2jh3A	2	0.4369	5	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.