DUF3551 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3551 - Protein of unknown function (DUF3551)

PFAM:	PF12071	Sequences: MRRLLLAALALAALAAAAAAPAQAPDYPWCAQGGGGGGYGNCGFTSLEQCRATASGRGGFCVPNPYYAGAQPRRRD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (67)
Sequences:	12224 (8438)
Seq/√Len:	1030.8
META:	0.97

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_L	51_R	3.510	1.00
31_A	54_A	3.178	1.00
27_Y	45_T	2.732	1.00
45_T	49_Q	2.657	1.00
21_P	24_A	2.392	1.00
48_E	52_A	2.159	1.00
48_E	51_R	2.128	1.00
40_G	62_V	2.027	1.00
32_Q	62_V	1.824	1.00
29_W	47_L	1.733	1.00
54_A	57_R	1.546	1.00
54_A	59_G	1.456	1.00
19_A	24_A	1.453	1.00
52_A	55_S	1.441	1.00
62_V	65_P	1.395	1.00
51_R	55_S	1.362	1.00
10_A	13_A	1.348	1.00
3_R	6_L	1.319	1.00
28_P	63_P	1.318	1.00
29_W	63_P	1.314	1.00
32_Q	40_G	1.232	1.00
11_L	14_L	1.209	1.00
9_L	12_A	1.170	1.00
51_R	54_A	1.154	1.00
20_A	23_Q	1.152	1.00
53_T	57_R	1.144	1.00
41_N	44_F	1.100	1.00
32_Q	36_G	1.067	1.00
28_P	67_Y	1.059	1.00
28_P	46_S	1.033	1.00
33_G	36_G	1.006	1.00
36_G	39_Y	1.004	1.00
26_D	66_Y	0.983	1.00
11_L	15_A	0.983	1.00
4_L	8_A	0.982	1.00
31_A	53_T	0.977	1.00
32_Q	38_G	0.970	1.00
20_A	24_A	0.966	1.00
32_Q	37_G	0.935	1.00
12_A	15_A	0.933	1.00
15_A	18_A	0.930	1.00
13_A	16_A	0.910	1.00
5_L	9_L	0.887	1.00
19_A	22_A	0.871	1.00
35_G	38_G	0.857	1.00
25_P	45_T	0.851	1.00
49_Q	53_T	0.841	1.00
31_A	59_G	0.833	1.00
34_G	37_G	0.833	1.00
34_G	39_Y	0.818	1.00
33_G	37_G	0.812	1.00
28_P	45_T	0.811	1.00
39_Y	43_G	0.811	1.00
3_R	7_A	0.800	1.00
9_L	13_A	0.781	1.00
28_P	64_N	0.778	1.00
12_A	17_A	0.767	1.00
10_A	14_L	0.759	1.00
7_A	15_A	0.742	1.00
7_A	10_A	0.742	1.00
49_Q	52_A	0.737	1.00
19_A	23_Q	0.735	1.00
33_G	38_G	0.730	1.00
9_L	15_A	0.729	1.00
8_A	18_A	0.717	1.00
13_A	18_A	0.706	1.00
26_D	45_T	0.688	1.00
66_Y	69_G	0.674	1.00
11_L	16_A	0.664	1.00
27_Y	43_G	0.661	1.00
5_L	13_A	0.656	1.00
47_L	60_F	0.647	1.00
11_L	18_A	0.645	1.00
4_L	7_A	0.639	1.00
8_A	15_A	0.634	1.00
9_L	18_A	0.628	1.00
14_L	17_A	0.622	1.00
6_L	14_L	0.620	1.00
65_P	68_A	0.618	1.00
34_G	38_G	0.614	1.00
44_F	53_T	0.605	1.00
44_F	49_Q	0.585	1.00
8_A	12_A	0.582	1.00
26_D	68_A	0.578	1.00
17_A	21_P	0.565	1.00
36_G	60_F	0.562	1.00
14_L	18_A	0.559	1.00
9_L	14_L	0.555	1.00
46_S	49_Q	0.544	1.00
7_A	11_L	0.538	1.00
3_R	8_A	0.530	1.00
22_A	26_D	0.529	1.00
53_T	58_G	0.529	1.00
60_F	63_P	0.525	1.00
61_C	64_N	0.517	1.00
12_A	18_A	0.515	1.00
33_G	39_Y	0.513	1.00
9_L	17_A	0.512	1.00
27_Y	44_F	0.504	1.00
6_L	10_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kt0F	1	0.3026	39	0.827	Contact Map
1jb0F	1	0.3026	34.9	0.831	Contact Map
3v83A	6	0.6711	7.7	0.875	Contact Map
3zbiC	1	0.3158	5.6	0.883	Contact Map
3m8tA	1	0.5395	5.1	0.885	Contact Map
4fp5D	3	0.4605	4.8	0.886	Contact Map
2vdaB	1	0.2763	4.2	0.89	Contact Map
3bx4B	1	0.5789	3	0.897	Contact Map
4coqA	3	0.6842	2.8	0.899	Contact Map
2zzsA	4	0.5263	2.4	0.903	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.