DUF3464 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3464 - Protein of unknown function (DUF3464)

PFAM:	PF11947	Sequences: KERSRLPFEPKKKRKKKPKKKKKPKKSKKASANKEKKSKKKSKPKRSSSAIPEVVSNRMARRMAFFCGIPTALGMSVFVVSYYLVTRNIAELPPWAVLLVSMGFFGLGLLGLSYGILSASWDEERPGSLLGWEEFKTNWGRMKAAWKEAR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	150 (138)
Sequences:	581 (414)
Seq/√Len:	35.3
META:	0.566

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_T	108_G	5.280	1.00
117_L	142_M	4.146	1.00
84_L	89_I	3.825	1.00
84_L	90_A	3.383	1.00
53_E	57_N	2.932	1.00
77_V	104_F	2.759	1.00
100_V	104_F	2.214	0.99
125_R	129_L	2.159	0.99
77_V	81_S	2.142	0.99
103_G	110_L	2.104	0.99
98_L	104_F	2.074	0.99
18_P	21_K	1.990	0.98
125_R	128_S	1.978	0.98
33_N	38_S	1.841	0.97
60_A	67_C	1.747	0.96
75_M	79_V	1.712	0.95
79_V	101_S	1.692	0.95
102_M	109_L	1.667	0.95
103_G	107_L	1.665	0.95
98_L	102_M	1.646	0.94
75_M	105_F	1.641	0.94
25_K	28_K	1.552	0.92
137_T	141_R	1.550	0.92
96_A	100_V	1.516	0.91
60_A	75_M	1.509	0.91
53_E	78_F	1.508	0.91
78_F	97_V	1.459	0.90
21_K	27_S	1.448	0.89
22_K	28_K	1.438	0.89
16_K	19_K	1.388	0.87
28_K	31_S	1.372	0.87
36_K	40_K	1.351	0.86
144_A	148_E	1.347	0.86
101_S	104_F	1.344	0.86
132_W	136_K	1.323	0.85
61_R	84_L	1.298	0.84
15_K	20_K	1.286	0.83
13_K	19_K	1.274	0.82
137_T	142_M	1.270	0.82
56_S	79_V	1.233	0.80
54_V	124_E	1.218	0.79
76_S	80_V	1.218	0.79
82_Y	101_S	1.217	0.79
23_K	26_K	1.210	0.79
139_W	143_K	1.193	0.78
11_K	18_P	1.188	0.78
87_R	107_L	1.171	0.77
74_G	105_F	1.158	0.76
107_L	141_R	1.127	0.74
17_K	21_K	1.117	0.73
29_K	32_A	1.106	0.72
74_G	93_P	1.099	0.72
73_L	107_L	1.098	0.72
16_K	20_K	1.096	0.72
56_S	141_R	1.092	0.71
65_F	129_L	1.091	0.71
17_K	25_K	1.089	0.71
59_M	105_F	1.089	0.71
45_K	48_S	1.060	0.69
102_M	145_A	1.049	0.68
75_M	99_L	1.048	0.68
78_F	112_L	1.041	0.68
94_P	113_S	1.039	0.68
134_E	137_T	1.038	0.67
18_P	22_K	1.032	0.67
63_M	112_L	1.020	0.66
66_F	135_F	1.004	0.65
97_V	135_F	0.988	0.64
89_I	112_L	0.982	0.63
120_S	127_G	0.971	0.62
37_K	40_K	0.959	0.61
82_Y	115_G	0.956	0.61
17_K	24_P	0.953	0.61
82_Y	113_S	0.945	0.60
91_E	144_A	0.945	0.60
104_F	112_L	0.942	0.60
80_V	124_E	0.942	0.60
57_N	113_S	0.939	0.60
81_S	98_L	0.928	0.59
65_F	83_Y	0.924	0.58
101_S	113_S	0.918	0.58
97_V	102_M	0.914	0.58
114_Y	118_S	0.911	0.57
64_A	108_G	0.910	0.57
106_G	146_W	0.906	0.57
124_E	133_E	0.903	0.57
56_S	82_Y	0.903	0.57
24_P	30_A	0.902	0.56
56_S	109_L	0.895	0.56
55_V	119_A	0.894	0.56
35_E	38_S	0.893	0.56
19_K	22_K	0.892	0.56
137_T	140_G	0.892	0.56
128_S	134_E	0.883	0.55
13_K	18_P	0.882	0.55
49_S	116_I	0.873	0.54
122_D	145_A	0.872	0.54
133_E	136_K	0.867	0.54
114_Y	124_E	0.866	0.53
51_I	82_Y	0.863	0.53
79_V	104_F	0.856	0.53
112_L	145_A	0.853	0.52
69_I	124_E	0.851	0.52
61_R	129_L	0.835	0.51
86_T	92_L	0.833	0.51
81_S	126_P	0.831	0.50
53_E	94_P	0.826	0.50
67_C	105_F	0.822	0.50
19_K	26_K	0.811	0.49
102_M	134_E	0.804	0.48
37_K	46_R	0.804	0.48
28_K	32_A	0.803	0.48
60_A	64_A	0.798	0.48
74_G	106_G	0.793	0.47
24_P	29_K	0.779	0.46
56_S	59_M	0.776	0.46
23_K	43_K	0.776	0.46
37_K	41_K	0.771	0.45
122_D	125_R	0.757	0.44
37_K	42_S	0.756	0.44
64_A	137_T	0.750	0.43
48_S	90_A	0.749	0.43
60_A	71_T	0.747	0.43
27_S	38_S	0.746	0.43
11_K	23_K	0.745	0.43
50_A	116_I	0.745	0.43
27_S	30_A	0.738	0.42
21_K	29_K	0.726	0.41
56_S	135_F	0.726	0.41
135_F	139_W	0.725	0.41
31_S	37_K	0.718	0.41
61_R	119_A	0.713	0.40
44_P	60_A	0.713	0.40
19_K	25_K	0.711	0.40
88_N	137_T	0.710	0.40
100_V	146_W	0.709	0.40
17_K	20_K	0.707	0.40
20_K	27_S	0.701	0.39
25_K	29_K	0.701	0.39
23_K	27_S	0.692	0.39
65_F	113_S	0.682	0.38
113_S	117_L	0.679	0.38
69_I	78_F	0.676	0.37
38_S	41_K	0.674	0.37
93_P	113_S	0.669	0.37
22_K	26_K	0.665	0.36
26_K	30_A	0.663	0.36
18_P	26_K	0.657	0.36
13_K	16_K	0.654	0.36
75_M	101_S	0.654	0.36
17_K	29_K	0.652	0.35
117_L	143_K	0.648	0.35
14_R	20_K	0.646	0.35
128_S	143_K	0.645	0.35
18_P	25_K	0.640	0.34
36_K	144_A	0.636	0.34
52_P	138_N	0.635	0.34
71_T	77_V	0.629	0.34
92_L	116_I	0.627	0.33
94_P	101_S	0.625	0.33
26_K	29_K	0.621	0.33
18_P	24_P	0.621	0.33
67_C	135_F	0.620	0.33
15_K	18_P	0.619	0.33
101_S	112_L	0.619	0.33
77_V	116_I	0.614	0.33
83_Y	122_D	0.610	0.32
63_M	81_S	0.604	0.32
41_K	45_K	0.599	0.31
20_K	24_P	0.598	0.31
42_S	46_R	0.595	0.31
52_P	58_R	0.590	0.31
66_F	116_I	0.582	0.30
66_F	97_V	0.575	0.30
55_V	58_R	0.575	0.30
32_A	37_K	0.573	0.29
29_K	33_N	0.571	0.29
18_P	29_K	0.568	0.29
84_L	88_N	0.567	0.29
87_R	94_P	0.566	0.29
104_F	126_P	0.563	0.29
51_I	59_M	0.562	0.29
64_A	101_S	0.550	0.28
127_G	131_G	0.548	0.28
102_M	136_K	0.545	0.28
33_N	37_K	0.543	0.27
85_V	92_L	0.541	0.27
143_K	146_W	0.535	0.27
128_S	133_E	0.533	0.27
59_M	141_R	0.532	0.27
81_S	104_F	0.532	0.27
49_S	145_A	0.531	0.27
79_V	140_G	0.530	0.26
12_K	16_K	0.530	0.26
24_P	28_K	0.523	0.26
81_S	85_V	0.522	0.26
55_V	134_E	0.521	0.26
58_R	138_N	0.521	0.26
56_S	77_V	0.521	0.26
21_K	28_K	0.518	0.26
18_P	28_K	0.515	0.26
11_K	16_K	0.513	0.25
21_K	26_K	0.513	0.25
134_E	138_N	0.511	0.25
99_L	119_A	0.508	0.25
112_L	141_R	0.505	0.25
17_K	23_K	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rh5C	1	0.2133	8.9	0.957	Contact Map
4ldsA	2	0.9667	8.5	0.957	Contact Map
3effK	4	0.6067	6.7	0.959	Contact Map
4ogqF	1	0.2133	5.9	0.96	Contact Map
3k6gD	1	0.24	5.3	0.961	Contact Map
2clyA	1	0.2133	4.6	0.962	Contact Map
3wu2J	1	0.2533	4.5	0.962	Contact Map
3wdoA	1	0.4	4.2	0.963	Contact Map
1qb3A	2	0.1733	3.7	0.964	Contact Map
3v5uA	1	0.36	3.5	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.