DUF3445 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3445 - Protein of unknown function (DUF3445)

PFAM:	PF11927	Sequences: MGLRPLDPDDWLEVDEHYAAELAEKRRLLAERPDEVFAALPGAEAAAWELLELLLEHLPARYPDLFRLDDGLRNRLTGEPLETAGRLVQEDLCLLQRRDGEYRLTAGVLCFPSSWSLAEKIGRPLAEIHAPVPGYDEKLARRVDRFFDRLQPGRPVWRFNWSLYDDPRLFQPPERPEYDPWGDARVTAENAGERLFLRVERQTLRRLPRSGAILFTIRTYLDPLAELK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	228 (223)
Sequences:	3033 (2262)
Seq/√Len:	151.4
META:	0.661

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
96_Q	105_T	3.853	1.00
50_L	214_L	3.798	1.00
24_E	27_R	3.171	1.00
27_R	31_E	3.049	1.00
203_T	216_T	2.736	1.00
38_A	121_I	2.695	1.00
43_A	47_A	2.594	1.00
25_K	108_V	2.555	1.00
85_G	108_V	2.543	1.00
88_V	92_L	2.406	1.00
18_Y	66_F	2.332	1.00
116_S	119_E	2.282	1.00
92_L	214_L	2.265	1.00
126_A	140_A	2.223	1.00
32_R	35_E	2.206	1.00
93_C	109_L	2.134	1.00
52_E	209_R	2.123	1.00
26_R	86_R	2.111	1.00
113_S	219_T	2.089	1.00
93_C	217_I	2.076	1.00
40_L	121_I	2.064	1.00
223_P	226_E	1.937	1.00
98_R	103_R	1.925	1.00
33_P	82_E	1.905	1.00
39_A	106_A	1.866	1.00
135_Y	143_V	1.853	1.00
166_D	171_Q	1.813	1.00
150_L	213_I	1.790	1.00
24_E	168_R	1.783	1.00
12_L	54_L	1.782	1.00
50_L	92_L	1.758	1.00
193_E	225_A	1.714	1.00
6_L	155_P	1.713	1.00
97_R	148_D	1.684	1.00
98_R	101_E	1.663	1.00
150_L	204_L	1.661	1.00
47_A	106_A	1.661	1.00
28_L	36_V	1.658	1.00
84_A	92_L	1.631	1.00
96_Q	212_A	1.612	1.00
39_A	43_A	1.610	1.00
104_L	128_I	1.596	1.00
93_C	104_L	1.593	1.00
159_F	199_V	1.573	1.00
70_D	73_R	1.572	1.00
67_R	75_R	1.568	1.00
123_R	127_E	1.566	1.00
93_C	107_G	1.562	1.00
114_S	164_Y	1.498	1.00
56_E	60_A	1.493	1.00
24_E	111_F	1.485	1.00
40_L	122_G	1.483	1.00
156_V	204_L	1.470	1.00
15_D	89_Q	1.468	1.00
37_F	82_E	1.466	1.00
82_E	108_V	1.449	1.00
43_A	106_A	1.447	1.00
59_P	62_Y	1.445	1.00
57_H	61_R	1.438	1.00
102_Y	147_F	1.435	1.00
124_P	127_E	1.422	1.00
151_Q	154_R	1.414	1.00
6_L	157_W	1.413	1.00
18_Y	22_L	1.410	1.00
13_E	220_Y	1.402	1.00
126_A	144_D	1.399	1.00
35_E	170_F	1.376	1.00
67_R	73_R	1.366	1.00
17_H	21_E	1.366	1.00
125_L	147_F	1.356	1.00
39_A	44_E	1.342	1.00
71_G	74_N	1.333	1.00
32_R	170_F	1.309	1.00
39_A	47_A	1.302	1.00
14_V	18_Y	1.296	1.00
163_L	195_L	1.286	1.00
46_A	212_A	1.268	1.00
125_L	143_V	1.262	1.00
21_E	89_Q	1.257	1.00
44_E	48_W	1.254	1.00
7_D	10_D	1.243	1.00
102_Y	148_D	1.228	1.00
49_E	210_S	1.221	1.00
109_L	117_L	1.213	1.00
135_Y	140_A	1.196	1.00
29_L	108_V	1.151	1.00
35_E	118_A	1.148	1.00
48_W	52_E	1.141	1.00
94_L	212_A	1.131	1.00
114_S	173_P	1.129	1.00
135_Y	144_D	1.105	0.99
43_A	96_Q	1.100	0.99
29_L	33_P	1.095	0.99
114_S	171_Q	1.088	0.99
53_L	207_L	1.080	0.99
113_S	164_Y	1.078	0.99
102_Y	144_D	1.076	0.99
94_L	214_L	1.075	0.99
62_Y	66_F	1.073	0.99
73_R	76_L	1.071	0.99
38_A	118_A	1.069	0.99
22_L	25_K	1.064	0.99
50_L	207_L	1.064	0.99
33_P	37_F	1.063	0.99
71_G	76_L	1.045	0.99
25_K	85_G	1.040	0.99
93_C	121_I	1.038	0.99
45_A	96_Q	1.037	0.99
82_E	86_R	1.034	0.99
103_R	124_P	1.032	0.99
105_T	212_A	1.026	0.99
51_L	87_L	1.011	0.99
142_R	146_F	1.001	0.99
97_R	102_Y	1.000	0.99
104_L	107_G	0.995	0.99
97_R	100_G	0.994	0.99
54_L	84_A	0.992	0.99
191_A	194_R	0.990	0.99
11_W	205_R	0.982	0.99
17_H	20_A	0.978	0.99
35_E	116_S	0.974	0.99
139_L	142_R	0.958	0.98
53_L	205_R	0.955	0.98
164_Y	171_Q	0.955	0.98
19_A	23_A	0.950	0.98
74_N	77_T	0.950	0.98
101_E	124_P	0.949	0.98
92_L	216_T	0.949	0.98
57_H	62_Y	0.949	0.98
99_D	103_R	0.943	0.98
102_Y	206_R	0.940	0.98
107_G	117_L	0.936	0.98
104_L	202_Q	0.935	0.98
81_L	106_A	0.931	0.98
153_G	205_R	0.928	0.98
111_F	219_T	0.926	0.98
22_L	26_R	0.925	0.98
70_D	74_N	0.925	0.98
152_P	155_P	0.912	0.98
29_L	37_F	0.911	0.98
29_L	82_E	0.898	0.98
82_E	85_G	0.897	0.98
120_K	128_I	0.896	0.98
143_V	147_F	0.894	0.97
167_P	196_F	0.891	0.97
164_Y	221_L	0.887	0.97
51_L	84_A	0.881	0.97
40_L	105_T	0.880	0.97
187_T	190_N	0.879	0.97
113_S	160_N	0.875	0.97
185_R	188_A	0.874	0.97
54_L	92_L	0.873	0.97
18_Y	89_Q	0.866	0.97
138_K	142_R	0.865	0.97
90_E	216_T	0.864	0.97
101_E	144_D	0.863	0.97
58_L	88_V	0.863	0.97
50_L	81_L	0.861	0.97
145_R	149_R	0.860	0.97
59_P	68_L	0.844	0.96
47_A	94_L	0.835	0.96
222_D	226_E	0.834	0.96
178_Y	181_W	0.832	0.96
146_F	149_R	0.828	0.96
206_R	211_G	0.827	0.96
125_L	213_I	0.826	0.96
97_R	211_G	0.825	0.96
3_L	146_F	0.825	0.96
55_L	83_T	0.822	0.96
52_E	56_E	0.818	0.96
14_V	90_E	0.815	0.96
66_F	74_N	0.810	0.96
49_E	208_P	0.807	0.95
34_D	38_A	0.802	0.95
184_A	187_T	0.798	0.95
147_F	204_L	0.794	0.95
98_R	105_T	0.789	0.95
36_V	110_C	0.788	0.95
8_P	155_P	0.786	0.95
25_K	82_E	0.781	0.95
70_D	75_R	0.780	0.94
136_D	140_A	0.779	0.94
37_F	81_L	0.777	0.94
51_L	80_P	0.770	0.94
47_A	84_A	0.769	0.94
53_L	56_E	0.768	0.94
135_Y	139_L	0.765	0.94
44_E	80_P	0.764	0.94
120_K	131_P	0.762	0.94
204_L	213_I	0.758	0.94
124_P	128_I	0.757	0.94
199_V	220_Y	0.755	0.93
170_F	173_P	0.751	0.93
55_L	87_L	0.751	0.93
15_D	218_R	0.751	0.93
75_R	78_G	0.738	0.93
29_L	86_R	0.734	0.93
55_L	59_P	0.732	0.92
146_F	156_V	0.731	0.92
28_L	170_F	0.730	0.92
37_F	108_V	0.723	0.92
195_L	224_L	0.723	0.92
46_A	106_A	0.720	0.92
95_L	128_I	0.720	0.92
112_P	115_W	0.719	0.92
15_D	21_E	0.719	0.92
14_V	66_F	0.716	0.92
72_L	87_L	0.714	0.91
152_P	206_R	0.704	0.91
59_P	63_P	0.703	0.91
63_P	66_F	0.701	0.91
133_P	161_W	0.699	0.91
113_S	162_S	0.697	0.90
144_D	148_D	0.690	0.90
65_L	76_L	0.689	0.90
159_F	220_Y	0.687	0.90
179_D	182_G	0.686	0.90
204_L	216_T	0.682	0.90
207_L	214_L	0.680	0.89
115_W	120_K	0.678	0.89
155_P	205_R	0.676	0.89
40_L	43_A	0.669	0.89
70_D	76_L	0.657	0.88
150_L	206_R	0.653	0.87
15_D	18_Y	0.653	0.87
26_R	79_E	0.650	0.87
46_A	96_Q	0.650	0.87
47_A	51_L	0.649	0.87
166_D	221_L	0.649	0.87
53_L	57_H	0.648	0.87
43_A	105_T	0.647	0.87
47_A	80_P	0.641	0.86
146_F	206_R	0.638	0.86
4_R	157_W	0.628	0.85
55_L	72_L	0.625	0.85
186_V	190_N	0.625	0.85
151_Q	211_G	0.624	0.85
157_W	201_R	0.624	0.85
192_G	224_L	0.623	0.85
26_R	30_A	0.620	0.85
161_W	199_V	0.619	0.84
162_S	199_V	0.618	0.84
105_T	122_G	0.616	0.84
24_E	28_L	0.616	0.84
127_E	130_A	0.616	0.84
89_Q	218_R	0.608	0.83
50_L	88_V	0.605	0.83
114_S	162_S	0.604	0.83
95_L	105_T	0.603	0.83
49_E	207_L	0.602	0.83
8_P	205_R	0.602	0.83
14_V	89_Q	0.601	0.83
85_G	92_L	0.600	0.83
13_E	199_V	0.599	0.83
199_V	222_D	0.599	0.83
83_T	86_R	0.598	0.82
32_R	36_V	0.595	0.82
167_P	221_L	0.594	0.82
19_A	76_L	0.592	0.82
202_Q	207_L	0.592	0.82
95_L	102_Y	0.591	0.82
37_F	47_A	0.591	0.82
20_A	167_P	0.590	0.82
23_A	27_R	0.589	0.81
59_P	66_F	0.588	0.81
59_P	65_L	0.587	0.81
49_E	152_P	0.586	0.81
149_R	153_G	0.585	0.81
5_P	154_R	0.584	0.81
21_E	25_K	0.584	0.81
42_G	96_Q	0.582	0.81
5_P	156_V	0.582	0.81
73_R	78_G	0.579	0.80
72_L	76_L	0.576	0.80
61_R	66_F	0.576	0.80
56_E	209_R	0.576	0.80
135_Y	142_R	0.574	0.80
55_L	84_A	0.572	0.80
90_E	203_T	0.571	0.79
190_N	194_R	0.571	0.79
37_F	84_A	0.570	0.79
41_P	44_E	0.569	0.79
142_R	149_R	0.568	0.79
22_L	85_G	0.566	0.79
44_E	47_A	0.566	0.79
165_D	195_L	0.566	0.79
166_D	194_R	0.564	0.79
159_F	201_R	0.562	0.78
95_L	147_F	0.559	0.78
223_P	227_L	0.558	0.78
205_R	216_T	0.558	0.78
116_S	173_P	0.558	0.78
45_A	210_S	0.557	0.78
85_G	90_E	0.557	0.78
126_A	143_V	0.555	0.78
141_R	145_R	0.553	0.77
68_L	72_L	0.551	0.77
162_S	171_Q	0.550	0.77
75_R	79_E	0.548	0.77
74_N	78_G	0.544	0.76
89_Q	111_F	0.541	0.76
36_V	170_F	0.540	0.76
114_S	142_R	0.540	0.76
18_Y	74_N	0.539	0.75
104_L	117_L	0.537	0.75
178_Y	182_G	0.537	0.75
167_P	171_Q	0.536	0.75
190_N	193_E	0.533	0.75
115_W	217_I	0.533	0.75
17_H	89_Q	0.533	0.75
14_V	58_L	0.528	0.74
149_R	154_R	0.528	0.74
101_E	127_E	0.527	0.74
2_G	5_P	0.524	0.73
197_L	222_D	0.523	0.73
89_Q	220_Y	0.519	0.73
162_S	166_D	0.518	0.73
49_E	211_G	0.517	0.72
8_P	57_H	0.517	0.72
3_L	161_W	0.516	0.72
72_L	77_T	0.515	0.72
28_L	111_F	0.514	0.72
10_D	13_E	0.511	0.72
133_P	162_S	0.509	0.71
58_L	62_Y	0.508	0.71
206_R	213_I	0.507	0.71
54_L	59_P	0.506	0.71
25_K	111_F	0.505	0.71
94_L	106_A	0.504	0.71
54_L	88_V	0.504	0.71
14_V	61_R	0.503	0.70
18_Y	65_L	0.502	0.70
31_E	34_D	0.502	0.70
80_P	117_L	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2p4gA	2	0.3289	19.5	0.958	Contact Map
4ha7A	2	0.2939	14.8	0.96	Contact Map
3jy6A	2	0.6228	10.3	0.963	Contact Map
3gybA	2	0.6184	9.6	0.963	Contact Map
4jenA	2	0.5044	6.3	0.966	Contact Map
2y3aB	1	0.4561	6.1	0.966	Contact Map
2aznA	2	0.2632	5.7	0.967	Contact Map
2gj3A	7	0.5263	5.2	0.967	Contact Map
3clkA	2	0.614	5.1	0.967	Contact Map
3k9cA	2	0.614	5	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.