DUF3413 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3413 - Domain of unknown function (DUF3413)

PFAM:	PF11893	Sequences: NQYREKRSRLLRWGHWFALFNILLALLIGLRYLFYSPWPDTLLGWLYLLLAWLGHFAFLALLPFLLLLFPLTLLLPSRRLLRGLAVLLATLGLTLLLLDTLVFALYRFHLNGFVLNLLTTPGGGEIFGSWLFLALIFLVILALELLLARWLWRRLRRLPRRRLGRPLALLLLLCFLASHLIHAWADANYYRPITSQTRYLPLYYPLTAKRFLAKLGLVDPEEYRERLALQGRPSAGSLNYPLAPLQC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	247 (239)
Sequences:	1479 (1175)
Seq/√Len:	76.0
META:	0.734

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_N	144_E	4.296	1.00
183_A	208_A	4.200	1.00
186_D	209_K	4.155	1.00
211_F	215_L	3.986	1.00
187_A	212_L	3.723	1.00
126_I	129_S	3.430	1.00
125_E	129_S	3.376	1.00
115_L	119_T	3.135	1.00
124_G	127_F	3.122	1.00
148_A	152_W	2.900	1.00
66_L	70_P	2.665	1.00
31_R	100_T	2.598	1.00
186_D	207_T	2.569	1.00
99_D	109_H	2.568	1.00
103_F	199_Y	2.565	1.00
14_G	64_F	2.557	1.00
239_N	242_L	2.510	1.00
110_L	115_L	2.441	1.00
187_A	208_A	2.370	1.00
123_G	127_F	2.312	1.00
28_I	100_T	2.282	1.00
125_E	128_G	2.245	1.00
208_A	212_L	2.194	1.00
183_A	206_L	2.192	1.00
175_F	179_H	2.181	1.00
124_G	129_S	2.152	1.00
124_G	128_G	2.114	1.00
50_L	174_C	2.104	1.00
164_G	168_A	1.843	1.00
62_L	67_L	1.839	1.00
116_N	120_T	1.791	1.00
59_L	63_P	1.782	1.00
21_N	24_L	1.773	1.00
60_A	63_P	1.768	1.00
59_L	62_L	1.764	1.00
130_W	134_A	1.761	1.00
54_G	174_C	1.736	1.00
175_F	178_S	1.705	1.00
55_H	59_L	1.677	1.00
120_T	127_F	1.626	1.00
55_H	179_H	1.609	1.00
184_W	188_N	1.593	0.99
179_H	206_L	1.589	0.99
123_G	126_I	1.573	0.99
209_K	212_L	1.560	0.99
114_V	118_L	1.552	0.99
123_G	128_G	1.531	0.99
183_A	212_L	1.512	0.99
20_F	147_L	1.493	0.99
16_W	164_G	1.490	0.99
204_Y	208_A	1.488	0.99
179_H	182_H	1.446	0.99
99_D	202_L	1.438	0.99
89_A	93_L	1.432	0.99
133_L	144_E	1.420	0.99
47_Y	51_A	1.416	0.99
52_W	200_L	1.414	0.99
121_P	125_E	1.414	0.99
25_A	93_L	1.390	0.99
17_F	144_E	1.376	0.98
149_R	153_R	1.370	0.98
95_L	176_L	1.361	0.98
17_F	21_N	1.354	0.98
47_Y	197_T	1.346	0.98
32_Y	99_D	1.334	0.98
208_A	211_F	1.334	0.98
150_W	154_R	1.334	0.98
177_A	180_L	1.327	0.98
207_T	210_R	1.286	0.98
112_G	122_G	1.271	0.97
243_A	246_Q	1.270	0.97
47_Y	189_Y	1.263	0.97
39_P	44_G	1.260	0.97
193_I	205_P	1.252	0.97
178_S	203_Y	1.250	0.97
178_S	182_H	1.248	0.97
182_H	205_P	1.227	0.97
113_F	128_G	1.225	0.97
142_A	146_L	1.214	0.97
51_A	55_H	1.198	0.96
123_G	129_S	1.196	0.96
165_R	169_L	1.164	0.96
131_L	144_E	1.158	0.96
108_F	199_Y	1.155	0.96
187_A	209_K	1.150	0.95
179_H	203_Y	1.148	0.95
183_A	211_F	1.146	0.95
139_V	144_E	1.138	0.95
94_T	98_L	1.131	0.95
102_V	117_L	1.124	0.95
235_A	239_N	1.123	0.95
18_A	63_P	1.122	0.95
70_P	73_L	1.116	0.95
13_W	148_A	1.114	0.95
185_A	192_P	1.112	0.94
11_L	14_G	1.087	0.94
131_L	134_A	1.083	0.94
197_T	203_Y	1.081	0.94
171_L	175_F	1.067	0.93
238_L	244_P	1.065	0.93
19_L	23_L	1.065	0.93
67_L	70_P	1.060	0.93
18_A	22_I	1.059	0.93
107_R	128_G	1.039	0.92
90_T	141_L	1.028	0.92
25_A	96_L	1.024	0.92
103_F	202_L	1.016	0.91
131_L	135_L	1.008	0.91
144_E	148_A	1.007	0.91
59_L	92_G	1.002	0.91
96_L	202_L	1.002	0.91
212_L	216_G	0.999	0.91
22_I	26_L	0.997	0.91
26_L	52_W	0.995	0.90
25_A	28_I	0.993	0.90
188_N	217_L	0.990	0.90
63_P	66_L	0.989	0.90
95_L	110_L	0.988	0.90
168_A	172_L	0.986	0.90
185_A	194_T	0.978	0.90
182_H	197_T	0.973	0.89
118_L	123_G	0.970	0.89
164_G	167_L	0.968	0.89
182_H	208_A	0.964	0.89
132_F	135_L	0.923	0.87
67_L	85_A	0.922	0.87
120_T	126_I	0.922	0.87
82_R	85_A	0.917	0.86
18_A	54_G	0.912	0.86
8_S	11_L	0.912	0.86
108_F	118_L	0.908	0.86
187_A	219_D	0.906	0.86
162_R	165_R	0.901	0.85
91_L	151_L	0.900	0.85
102_V	126_I	0.897	0.85
146_L	150_W	0.895	0.85
146_L	149_R	0.891	0.85
109_H	201_P	0.890	0.85
145_L	149_R	0.888	0.85
63_P	67_L	0.887	0.85
102_V	105_L	0.886	0.85
36_S	39_P	0.885	0.84
83_G	87_L	0.884	0.84
206_L	210_R	0.881	0.84
222_E	226_R	0.878	0.84
100_T	107_R	0.875	0.84
114_V	117_L	0.865	0.83
107_R	199_Y	0.863	0.83
147_L	151_L	0.862	0.83
112_G	115_L	0.856	0.82
102_V	205_P	0.854	0.82
57_A	62_L	0.850	0.82
122_G	129_S	0.850	0.82
184_W	217_L	0.849	0.82
144_E	147_L	0.842	0.81
185_A	193_I	0.841	0.81
19_L	157_R	0.836	0.81
195_S	199_Y	0.826	0.80
172_L	183_A	0.822	0.80
38_W	45_W	0.815	0.79
214_K	233_P	0.814	0.79
51_A	113_F	0.813	0.79
189_Y	195_S	0.809	0.79
119_T	123_G	0.809	0.79
47_Y	194_T	0.806	0.78
177_A	181_I	0.798	0.78
29_G	56_F	0.797	0.78
207_T	212_L	0.796	0.78
52_W	191_R	0.794	0.77
46_L	173_L	0.793	0.77
184_W	187_A	0.789	0.77
131_L	142_A	0.787	0.77
121_P	126_I	0.786	0.77
16_W	19_L	0.785	0.77
174_C	212_L	0.781	0.76
176_L	180_L	0.772	0.75
12_R	15_H	0.772	0.75
120_T	129_S	0.768	0.75
108_F	111_N	0.767	0.75
57_A	60_A	0.766	0.75
120_T	128_G	0.761	0.74
122_G	126_I	0.761	0.74
27_L	30_L	0.755	0.74
95_L	117_L	0.755	0.74
138_L	142_A	0.750	0.73
55_H	60_A	0.748	0.73
31_R	37_P	0.743	0.73
10_L	81_L	0.741	0.72
10_L	76_P	0.739	0.72
113_F	123_G	0.739	0.72
65_L	166_P	0.739	0.72
107_R	198_R	0.738	0.72
102_V	182_H	0.738	0.72
62_L	70_P	0.737	0.72
27_L	244_P	0.736	0.72
11_L	176_L	0.735	0.72
32_Y	45_W	0.735	0.72
102_V	127_F	0.734	0.72
101_L	104_A	0.733	0.72
183_A	194_T	0.730	0.71
122_G	125_E	0.730	0.71
51_A	200_L	0.728	0.71
66_L	74_L	0.726	0.71
99_D	200_L	0.722	0.70
189_Y	224_R	0.718	0.70
77_S	174_C	0.706	0.69
51_A	54_G	0.705	0.69
90_T	196_Q	0.701	0.68
8_S	12_R	0.699	0.68
162_R	169_L	0.698	0.68
173_L	246_Q	0.696	0.68
47_Y	208_A	0.695	0.68
62_L	87_L	0.694	0.67
106_Y	182_H	0.693	0.67
79_R	88_L	0.688	0.67
54_G	175_F	0.686	0.67
137_F	153_R	0.685	0.66
136_I	139_V	0.683	0.66
51_A	202_L	0.682	0.66
48_L	202_L	0.681	0.66
184_W	208_A	0.670	0.65
103_F	132_F	0.666	0.64
27_L	31_R	0.662	0.64
10_L	13_W	0.662	0.64
223_Y	227_L	0.659	0.63
47_Y	202_L	0.658	0.63
80_L	143_L	0.658	0.63
133_L	139_V	0.657	0.63
76_P	83_G	0.657	0.63
95_L	181_I	0.655	0.63
111_N	114_V	0.654	0.63
187_A	217_L	0.653	0.63
203_Y	206_L	0.651	0.62
114_V	121_P	0.651	0.62
55_H	58_F	0.651	0.62
242_L	245_L	0.650	0.62
18_A	127_F	0.649	0.62
102_V	124_G	0.648	0.62
179_H	207_T	0.648	0.62
45_W	49_L	0.647	0.62
13_W	17_F	0.647	0.62
77_S	167_L	0.645	0.62
51_A	203_Y	0.645	0.62
144_E	151_L	0.644	0.62
181_I	245_L	0.641	0.61
59_L	137_F	0.640	0.61
135_L	144_E	0.640	0.61
13_W	186_D	0.636	0.61
89_A	92_G	0.633	0.60
11_L	15_H	0.631	0.60
51_A	178_S	0.631	0.60
185_A	190_Y	0.622	0.59
146_L	153_R	0.622	0.59
86_V	148_A	0.622	0.59
55_H	189_Y	0.621	0.59
84_L	134_A	0.620	0.59
231_G	242_L	0.619	0.59
63_P	104_A	0.617	0.58
182_H	185_A	0.617	0.58
55_H	120_T	0.612	0.58
48_L	52_W	0.610	0.58
114_V	119_T	0.609	0.57
32_Y	109_H	0.606	0.57
111_N	208_A	0.604	0.57
23_L	177_A	0.603	0.57
181_I	193_I	0.603	0.57
144_E	153_R	0.601	0.56
108_F	120_T	0.600	0.56
68_L	141_L	0.600	0.56
132_F	136_I	0.599	0.56
180_L	184_W	0.599	0.56
173_L	177_A	0.598	0.56
111_N	122_G	0.594	0.56
113_F	204_Y	0.593	0.55
84_L	87_L	0.591	0.55
113_F	197_T	0.590	0.55
148_A	151_L	0.586	0.55
45_W	195_S	0.585	0.54
73_L	103_F	0.584	0.54
181_I	192_P	0.581	0.54
182_H	204_Y	0.580	0.54
137_F	145_L	0.579	0.54
55_H	178_S	0.579	0.54
21_N	28_I	0.577	0.53
19_L	44_G	0.576	0.53
138_L	159_P	0.574	0.53
149_R	154_R	0.571	0.53
113_F	126_I	0.570	0.53
222_E	225_E	0.569	0.52
28_I	93_L	0.568	0.52
150_W	153_R	0.568	0.52
147_L	153_R	0.566	0.52
195_S	204_Y	0.566	0.52
56_F	59_L	0.564	0.52
113_F	186_D	0.564	0.52
182_H	186_D	0.564	0.52
113_F	179_H	0.563	0.52
112_G	200_L	0.563	0.52
241_P	244_P	0.563	0.52
161_R	166_P	0.563	0.52
136_I	147_L	0.559	0.51
156_R	169_L	0.556	0.51
140_I	150_W	0.555	0.51
94_T	122_G	0.554	0.50
163_L	166_P	0.552	0.50
115_L	197_T	0.552	0.50
195_S	198_R	0.552	0.50
72_T	140_I	0.551	0.50
179_H	204_Y	0.550	0.50
118_L	122_G	0.550	0.50
187_A	206_L	0.548	0.50
104_A	191_R	0.547	0.50
233_P	239_N	0.547	0.50
47_Y	113_F	0.544	0.49
37_P	42_L	0.544	0.49
53_L	64_F	0.543	0.49
117_L	127_F	0.542	0.49
13_W	152_W	0.542	0.49
101_L	109_H	0.539	0.49
31_R	99_D	0.539	0.49
16_W	22_I	0.539	0.49
87_L	169_L	0.538	0.48
103_F	233_P	0.537	0.48
65_L	153_R	0.536	0.48
51_A	171_L	0.535	0.48
130_W	144_E	0.534	0.48
216_G	219_D	0.533	0.48
204_Y	207_T	0.533	0.48
57_A	66_L	0.532	0.48
108_F	114_V	0.532	0.48
157_R	161_R	0.526	0.47
87_L	141_L	0.522	0.46
97_L	131_L	0.522	0.46
159_P	172_L	0.522	0.46
43_L	177_A	0.520	0.46
186_D	204_Y	0.519	0.46
32_Y	41_T	0.518	0.46
55_H	208_A	0.517	0.46
141_L	155_L	0.517	0.46
173_L	180_L	0.516	0.46
79_R	157_R	0.516	0.46
48_L	65_L	0.514	0.45
102_V	121_P	0.514	0.45
121_P	128_G	0.513	0.45
217_L	220_P	0.513	0.45
113_F	118_L	0.511	0.45
222_E	233_P	0.510	0.45
55_H	127_F	0.510	0.45
22_I	25_A	0.509	0.45
111_N	209_K	0.509	0.45
206_L	211_F	0.509	0.45
105_L	111_N	0.508	0.45
144_E	152_W	0.505	0.44
23_L	172_L	0.505	0.44
56_F	209_K	0.504	0.44
60_A	64_F	0.502	0.44
80_L	84_L	0.500	0.44
113_F	116_N	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4i0uA	4	0.2753	8.7	0.954	Contact Map
2l2tA	2	0.1781	8.5	0.955	Contact Map
4ev6A	3	0.2834	8.2	0.955	Contact Map
2m8rA	1	0.1498	3.4	0.963	Contact Map
1pi7A	1	0.0769	2.6	0.964	Contact Map
5bq9A	1	0.2794	2.6	0.965	Contact Map
2jwaA	2	0.1781	2.4	0.965	Contact Map
2cqyA	1	0.2065	2.2	0.966	Contact Map
2k1aA	1	0.17	1.8	0.968	Contact Map
2micA	2	0.1619	1.6	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.