DUF3323 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3323 - Protein of unknown function N-terminus (DUF3323)

PFAM:	PF11796	Sequences: LGGTVTLTDLTPEERRALAGLLGRPPRPGASLRVSLADLDAALRRSGFAGSGLREALEALFGGPLRDRAAERAAEAAAWAALFAALRAALAARPWLAAWLAKLRGDGLLRRLARGDPEAARRLLRQAARVLARLPADGVPLAVLAARVTGDAHALDDGTPLGTLVLRALAALAGLPPPADAEERRELWARAGVLVDDLSSTVLVLGLPA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	209 (206)
Sequences:	1586 (1319)
Seq/√Len:	91.9
META:	0.717

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
139_V	147_R	4.721	1.00
66_R	71_E	4.522	1.00
67_D	70_A	4.464	1.00
133_R	147_R	4.125	1.00
169_L	191_A	4.111	1.00
153_H	156_D	4.020	1.00
196_D	199_S	3.886	1.00
144_L	193_V	3.780	1.00
54_R	58_E	3.445	1.00
139_V	144_L	3.168	1.00
35_S	38_D	2.979	1.00
40_D	44_R	2.722	1.00
151_D	159_T	2.548	1.00
79_W	110_R	2.505	1.00
10_L	32_L	2.497	1.00
10_L	18_L	2.411	1.00
155_L	165_V	2.360	1.00
170_A	178_P	2.263	1.00
57_L	62_G	2.170	1.00
158_G	163_T	2.137	1.00
4_T	33_R	2.132	1.00
130_V	155_L	2.075	1.00
11_T	14_E	2.063	1.00
149_T	161_L	2.061	1.00
198_L	203_L	2.024	1.00
85_A	121_R	2.006	1.00
52_G	55_E	1.973	1.00
180_D	183_E	1.951	1.00
40_D	52_G	1.865	1.00
173_A	191_A	1.823	1.00
127_A	161_L	1.809	1.00
83_F	124_L	1.809	1.00
165_V	188_W	1.807	1.00
80_A	84_A	1.786	1.00
204_V	207_L	1.735	1.00
149_T	155_L	1.735	1.00
157_D	184_R	1.729	1.00
133_R	148_V	1.727	1.00
125_R	129_R	1.726	1.00
86_L	100_L	1.725	1.00
146_A	152_A	1.599	1.00
131_L	166_L	1.598	1.00
131_L	168_A	1.584	1.00
41_A	45_R	1.547	1.00
127_A	165_V	1.516	1.00
10_L	15_R	1.473	1.00
103_L	107_G	1.468	1.00
87_R	101_A	1.466	1.00
51_S	55_E	1.439	0.99
73_A	77_A	1.426	0.99
130_V	165_V	1.416	0.99
17_A	21_L	1.385	0.99
152_A	156_D	1.375	0.99
74_A	78_A	1.371	0.99
188_W	193_V	1.291	0.99
70_A	74_A	1.277	0.99
6_T	33_R	1.256	0.99
79_W	120_A	1.247	0.98
162_G	166_L	1.227	0.98
169_L	187_L	1.223	0.98
10_L	20_G	1.198	0.98
122_R	126_Q	1.196	0.98
24_R	38_D	1.194	0.98
55_E	59_A	1.184	0.98
199_S	203_L	1.182	0.98
19_A	25_P	1.158	0.98
76_A	80_A	1.108	0.97
14_E	57_L	1.079	0.96
142_A	206_G	1.078	0.96
178_P	187_L	1.077	0.96
178_P	183_E	1.070	0.96
130_V	144_L	1.065	0.96
158_G	162_G	1.060	0.96
104_R	107_G	1.056	0.96
21_L	39_L	1.048	0.96
79_W	152_A	1.042	0.95
68_R	71_E	1.040	0.95
141_L	144_L	1.030	0.95
58_E	64_P	1.026	0.95
22_L	34_V	1.023	0.95
6_T	31_S	1.023	0.95
83_F	104_R	1.022	0.95
10_L	19_A	1.013	0.95
42_A	57_L	0.999	0.94
135_P	138_G	0.987	0.94
195_V	200_S	0.984	0.94
152_A	201_T	0.980	0.94
24_R	29_G	0.948	0.92
185_R	203_L	0.945	0.92
142_A	199_S	0.941	0.92
152_A	200_S	0.940	0.92
126_Q	149_T	0.936	0.92
19_A	22_L	0.931	0.92
15_R	29_G	0.928	0.92
138_G	192_G	0.925	0.92
43_L	162_G	0.920	0.91
144_L	148_V	0.913	0.91
183_E	187_L	0.913	0.91
16_R	20_G	0.910	0.91
69_A	73_A	0.909	0.91
11_T	19_A	0.907	0.91
172_L	178_P	0.900	0.90
94_P	97_A	0.895	0.90
108_L	194_L	0.891	0.90
140_P	197_D	0.876	0.89
185_R	197_D	0.875	0.89
108_L	163_T	0.868	0.89
7_L	14_E	0.865	0.89
188_W	203_L	0.864	0.88
161_L	165_V	0.863	0.88
87_R	97_A	0.856	0.88
149_T	154_A	0.855	0.88
162_G	188_W	0.845	0.87
196_D	200_S	0.843	0.87
193_V	208_P	0.840	0.87
189_A	194_L	0.840	0.87
110_R	113_A	0.834	0.87
108_L	112_L	0.827	0.86
126_Q	161_L	0.825	0.86
19_A	28_P	0.825	0.86
116_D	119_A	0.824	0.86
185_R	198_L	0.818	0.86
22_L	42_A	0.818	0.86
18_L	32_L	0.817	0.86
133_R	144_L	0.817	0.86
15_R	28_P	0.812	0.85
143_V	147_R	0.810	0.85
55_E	58_E	0.809	0.85
140_P	144_L	0.804	0.85
103_L	106_D	0.804	0.85
50_G	55_E	0.801	0.84
56_A	62_G	0.797	0.84
116_D	121_R	0.796	0.84
4_T	35_S	0.792	0.84
169_L	173_A	0.789	0.84
185_R	189_A	0.788	0.83
181_A	206_G	0.786	0.83
12_P	76_A	0.785	0.83
146_A	203_L	0.780	0.83
96_L	198_L	0.775	0.82
53_L	57_L	0.771	0.82
153_H	199_S	0.765	0.82
155_L	169_L	0.764	0.81
34_V	38_D	0.763	0.81
16_R	74_A	0.761	0.81
46_S	152_A	0.757	0.81
57_L	201_T	0.754	0.81
83_F	106_D	0.753	0.81
189_A	195_V	0.750	0.80
107_G	111_R	0.749	0.80
139_V	193_V	0.748	0.80
141_L	193_V	0.748	0.80
185_R	195_V	0.743	0.80
123_L	161_L	0.743	0.80
22_L	29_G	0.740	0.79
126_Q	154_A	0.738	0.79
36_L	53_L	0.738	0.79
6_T	10_L	0.738	0.79
90_L	143_V	0.738	0.79
75_E	114_R	0.736	0.79
153_H	196_D	0.736	0.79
167_R	170_A	0.733	0.79
127_A	155_L	0.731	0.79
90_L	96_L	0.730	0.78
107_G	112_L	0.723	0.78
132_A	168_A	0.722	0.78
155_L	188_W	0.722	0.78
25_P	28_P	0.714	0.77
187_L	191_A	0.714	0.77
131_L	169_L	0.714	0.77
9_D	30_A	0.714	0.77
185_R	202_V	0.709	0.76
143_V	166_L	0.708	0.76
185_R	188_W	0.707	0.76
94_P	157_D	0.707	0.76
165_V	169_L	0.704	0.76
49_A	62_G	0.704	0.76
14_E	100_L	0.702	0.76
198_L	201_T	0.694	0.75
6_T	206_G	0.692	0.75
177_P	183_E	0.692	0.75
9_D	32_L	0.691	0.75
155_L	207_L	0.691	0.75
203_L	206_G	0.688	0.74
6_T	143_V	0.687	0.74
121_R	125_R	0.682	0.74
129_R	132_A	0.681	0.74
154_A	161_L	0.680	0.73
60_L	124_L	0.676	0.73
142_A	146_A	0.676	0.73
116_D	120_A	0.674	0.73
142_A	196_D	0.667	0.72
107_G	113_A	0.664	0.72
6_T	16_R	0.664	0.72
15_R	19_A	0.660	0.71
188_W	192_G	0.658	0.71
82_L	117_P	0.656	0.71
79_W	83_F	0.655	0.71
109_L	116_D	0.648	0.70
121_R	124_L	0.647	0.70
174_G	177_P	0.647	0.70
96_L	99_W	0.646	0.70
40_D	46_S	0.643	0.69
126_Q	129_R	0.642	0.69
197_D	201_T	0.642	0.69
14_E	200_S	0.639	0.69
74_A	77_A	0.631	0.68
27_R	33_R	0.631	0.68
202_V	207_L	0.631	0.68
141_L	202_V	0.629	0.68
6_T	22_L	0.627	0.67
14_E	29_G	0.625	0.67
164_L	193_V	0.624	0.67
44_R	52_G	0.623	0.67
171_A	179_A	0.621	0.67
40_D	51_S	0.619	0.66
48_F	56_A	0.616	0.66
2_G	37_A	0.616	0.66
3_G	36_L	0.613	0.66
57_L	191_A	0.611	0.65
201_T	204_V	0.609	0.65
130_V	161_L	0.608	0.65
99_W	168_A	0.606	0.65
57_L	134_L	0.606	0.65
102_K	105_G	0.600	0.64
73_A	76_A	0.599	0.64
36_L	101_A	0.598	0.64
166_L	184_R	0.597	0.64
170_A	175_L	0.597	0.64
104_R	202_V	0.596	0.63
5_V	180_D	0.596	0.63
35_S	142_A	0.594	0.63
140_P	162_G	0.590	0.63
143_V	200_S	0.585	0.62
72_R	84_A	0.584	0.62
153_H	189_A	0.581	0.61
133_R	139_V	0.581	0.61
72_R	134_L	0.579	0.61
97_A	132_A	0.577	0.61
82_L	124_L	0.577	0.61
185_R	193_V	0.576	0.61
96_L	110_R	0.576	0.61
72_R	176_P	0.576	0.61
13_E	183_E	0.576	0.61
19_A	24_R	0.572	0.60
184_R	195_V	0.569	0.60
58_E	63_G	0.569	0.60
181_A	184_R	0.568	0.60
19_A	27_R	0.567	0.60
140_P	198_L	0.567	0.60
30_A	35_S	0.565	0.59
154_A	171_A	0.564	0.59
148_V	155_L	0.564	0.59
76_A	187_L	0.563	0.59
40_D	58_E	0.562	0.59
70_A	73_A	0.562	0.59
166_L	187_L	0.562	0.59
195_V	205_L	0.556	0.58
93_R	96_L	0.553	0.58
197_D	205_L	0.553	0.58
42_A	48_F	0.553	0.58
84_A	175_L	0.550	0.57
145_A	165_V	0.549	0.57
63_G	67_D	0.549	0.57
39_L	159_T	0.548	0.57
15_R	18_L	0.546	0.57
167_R	171_A	0.545	0.57
133_R	191_A	0.543	0.56
17_A	43_L	0.542	0.56
127_A	130_V	0.541	0.56
82_L	113_A	0.540	0.56
129_R	133_R	0.540	0.56
80_A	119_A	0.539	0.56
8_T	34_V	0.538	0.56
62_G	65_L	0.538	0.56
122_R	125_R	0.537	0.55
123_L	160_P	0.536	0.55
26_P	113_A	0.533	0.55
66_R	74_A	0.532	0.55
43_L	53_L	0.532	0.55
39_L	158_G	0.532	0.55
41_A	80_A	0.531	0.55
102_K	106_D	0.528	0.54
148_V	197_D	0.528	0.54
7_L	148_V	0.527	0.54
69_A	129_R	0.526	0.54
84_A	179_A	0.524	0.54
12_P	16_R	0.524	0.54
162_G	165_V	0.522	0.53
4_T	36_L	0.518	0.53
7_L	59_A	0.518	0.53
28_P	73_A	0.518	0.53
26_P	66_R	0.516	0.53
146_A	163_T	0.515	0.52
185_R	200_S	0.512	0.52
49_A	56_A	0.512	0.52
116_D	169_L	0.512	0.52
7_L	92_A	0.511	0.52
130_V	188_W	0.510	0.52
130_V	168_A	0.508	0.51
140_P	143_V	0.506	0.51
140_P	163_T	0.506	0.51
29_G	37_A	0.506	0.51
14_E	18_L	0.504	0.51
181_A	194_L	0.503	0.51
45_R	190_R	0.503	0.51
161_L	188_W	0.503	0.51
151_D	187_L	0.500	0.50
48_F	165_V	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ixmA	1	0.8469	35.4	0.936	Contact Map
2ixnA	1	0.8373	28.9	0.939	Contact Map
2ixoA	1	0.8995	22.1	0.942	Contact Map
3i5gC	1	0.7033	21.4	0.943	Contact Map
2l6aA	1	0.4306	19.8	0.944	Contact Map
1w7jB	1	0.5359	19.4	0.944	Contact Map
4qbdB	1	0.6938	19.4	0.944	Contact Map
3j04B	1	0.6364	17.5	0.945	Contact Map
2jnfA	1	0.6699	15.8	0.946	Contact Map
3qvsA	2	0.3589	15.5	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.